BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D05 (891 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0106 - 25611239-25611295,25611388-25611477,25611582-256116... 31 1.6 02_02_0236 + 8135641-8135795,8136167-8136557,8136640-8136931,813... 30 2.1 01_06_0919 - 32993752-32993856,32994383-32994592,32994666-329952... 30 2.1 04_03_0703 - 18870287-18871351,18871542-18871733 29 5.0 03_04_0118 + 17418558-17419310 29 5.0 05_04_0320 + 20181560-20182063,20182513-20182853,20183159-201838... 29 6.6 03_02_0936 - 12528336-12528379,12528516-12528602,12528696-125288... 29 6.6 >05_06_0106 - 25611239-25611295,25611388-25611477,25611582-25611669, 25611757-25611836,25611968-25612120,25612403-25612546, 25612633-25612884,25612985-25613116,25613207-25613287, 25613368-25613488,25613930-25614025,25614195-25614298, 25614481-25614567,25614690-25614803,25614871-25614930, 25615007-25615102,25615316-25615366,25615457-25615562, 25615642-25615713,25616117-25616172,25616446-25616508, 25616636-25616764 Length = 743 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = +2 Query: 5 GFSLERVSHGKVAMEFLNFKLIVCAFLLCLFVSVNTQSVHRRFEYKYSFKPPYLAQKDGS 184 G S R + G V F + V AF + LF + +SV F+ ++F+ K+G Sbjct: 12 GGSRLRNACGGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFNFRVTQFLSKNGI 71 Query: 185 VPFWEY 202 FW + Sbjct: 72 YEFWNW 77 >02_02_0236 + 8135641-8135795,8136167-8136557,8136640-8136931, 8137117-8137271,8137363-8137451,8137623-8137967, 8139046-8139169,8139424-8139581,8139673-8139757, 8140094-8140306,8141314-8141375,8141466-8141951, 8142472-8142568 Length = 883 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 725 SAPGAAPRSRRGSTARSPARCSSFRCGS-RQLTCSCSILSW 606 SAP A P +T PA+ RC S R + C I+ W Sbjct: 21 SAPSARPEYHECATCHGPAKTRCSRCKSVRYCSGKCQIIHW 61 >01_06_0919 - 32993752-32993856,32994383-32994592,32994666-32995220, 32995705-32995926,32996381-32996511,32997456-32998353, 32998453-32998530,32998612-32998683,32998728-32998763, 32999413-33000353,33000531-33000659,33000751-33000894, 33000994-33001060,33002434-33002502,33003144-33003278 Length = 1263 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +2 Query: 404 EVFGSSDKWNGLGVIFDSFDNDNKHNNPYIMAVVNDGTKVFDHKSDGTTQLLS 562 E+F + + W+ D H+ +M +N+G + FDH D + +LLS Sbjct: 91 EIFENKENWSNYS------HTDPSHSQMDVMVELNNGGESFDHSEDTSYRLLS 137 >04_03_0703 - 18870287-18871351,18871542-18871733 Length = 418 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 713 AAPRSRRGSTARSPARCSSFRCGSRQLTCS 624 A P S ST+ S ARC CG+R+ T S Sbjct: 243 AGPPSTGSSTSMSRARCCGSACGTRRSTWS 272 >03_04_0118 + 17418558-17419310 Length = 250 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = -1 Query: 393 SPRCVVYQNAKPSAPILPLPVI-LNMISTSHQSKLMGCLVHIAPFWLRSDGARRTLSPDA 217 +P C++ +P I P I +++++ +K M C+++ + F A R L+ + Sbjct: 133 APDCILMMEVEPKLEITMGPSITVSVLAHRKDTKKMACVINKSTFDYIDSNAARALAYEY 192 Query: 216 IAFPP 202 + F P Sbjct: 193 LQFSP 197 >05_04_0320 + 20181560-20182063,20182513-20182853,20183159-20183819, 20183954-20184112 Length = 554 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = -3 Query: 436 TVPFVRRAEHFAGVVASLCGIPECQAVSTYSASAGNLEHDIDLPPVKVNGLFGPYSPLLA 257 TV E +++ C + + + + T NL DI+ V + +F PY+PL+ Sbjct: 179 TVDLKHELEQLLLLISGRCLLGK-EVMGTKFDEVCNLFRDIE-GGVNLMSVFFPYTPLIP 236 Query: 256 SKRRRE 239 S RRR+ Sbjct: 237 SNRRRD 242 >03_02_0936 - 12528336-12528379,12528516-12528602,12528696-12528809, 12528895-12529120,12529200-12529523,12529603-12529773, 12529870-12530100,12530291-12530479,12531176-12531178 Length = 462 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = -3 Query: 421 RRAEHFAGVVASLCGIPECQAVSTYSASAGNLEHDIDLPPVKVNGLFGPYSPLLASK 251 R + FAG+ CG V +A AG L+H L +N ++ LASK Sbjct: 82 RYLDAFAGIATVCCGHCHPDVVGAIAAQAGRLQHSTVL---YLNHAIADFAEALASK 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,826,245 Number of Sequences: 37544 Number of extensions: 548430 Number of successful extensions: 1605 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1603 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -