BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D03 (849 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 27 0.17 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 25 1.2 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 2.0 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 4.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 8.2 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 27.5 bits (58), Expect = 0.17 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 697 HRKVKCSLLTWLGKW 741 HR+V C +L+W KW Sbjct: 59 HRRVTCDVLSWQSKW 73 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/54 (20%), Positives = 24/54 (44%) Frame = +3 Query: 537 TFITQQGIKSASKEEQAQITSQVTGQIGWRREGIKYRRNELFLDVLXYVNLLMS 698 T ++ QGI E ++++ T + WR F+ + Y+ +L++ Sbjct: 373 TKLSSQGILGEDVENNSEVSKSRTKESAWRHFAAIIEWLSFFIVIFTYIIILIT 426 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.8 bits (49), Expect = 2.0 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 165 VYNHKGEVLISRV--YRDDIGRNAVDAFRVNVIHARQQVRSPV 287 V N+ G V + Y D+ R A+D F+ + + ++ RSPV Sbjct: 297 VNNYMGPVATKAMKGYSDEDLREAIDEFKTPMRNDSERNRSPV 339 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 681 HTXVHQGTARFVCT*CLHGASQSDQLLV 598 H +H G CT C QS QL++ Sbjct: 166 HMRIHTGERPHKCTVCSKTFIQSGQLVI 193 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 681 HTXVHQGTARFVCT*CLHGASQSDQLLV 598 H H G +VC C G + S QL V Sbjct: 194 HMRTHTGEKPYVCKACGKGFTCSKQLKV 221 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -2 Query: 212 ISVDSRDQHLAFMVINEQAPDHCG 141 + V + DQ+ + ++I +PDH G Sbjct: 658 VHVTNMDQYNSILMIEHLSPDHNG 681 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = -2 Query: 356 LCDCCQPNICTLDMEERCACNVGN 285 LC CC + C +M C N Sbjct: 746 LCHCCDFDACDCEMTCPAGCKCYN 769 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,312 Number of Sequences: 438 Number of extensions: 5063 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -