BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C24 (985 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-ace... 30 0.58 SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4... 27 4.1 SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula... 26 9.4 >SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase Alg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 162 Score = 29.9 bits (64), Expect = 0.58 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 130 YVARSESIMRDSDVAFSHSAALAIAQVRRNGNRII 26 Y ES + D+ + SH+ A +I Q R+G R++ Sbjct: 63 YAPEIESYIHDASIVISHAGAGSILQTLRSGKRLL 97 >SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 27.1 bits (57), Expect = 4.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 206 VRVHRANTGRSSNELDRXTTELER 277 +R H+ + GR+ ELDR T+L++ Sbjct: 18 LRAHQRSLGRAERELDRERTKLDQ 41 >SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1400 Score = 25.8 bits (54), Expect = 9.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 12 MSTTYIILLPFLLTCAIASAAECENATSLS 101 +S TYIILLPF C A +++ +S Sbjct: 1023 LSKTYIILLPFQSLCPGGKQANHQSSEKMS 1052 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,676,772 Number of Sequences: 5004 Number of extensions: 23993 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 507285244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -