BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C21 (861 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4... 31 0.28 SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizos... 27 3.4 SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M... 27 4.5 SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2... 27 4.5 SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|S... 26 7.9 >SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 207 VRVHRADTGRSSNELDRQTTELERRGMGL-QHLAG 308 +R H+ GR+ ELDR+ T+L++R L Q + G Sbjct: 18 LRAHQRSLGRAERELDRERTKLDQRERALIQEIKG 52 >SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 650 Score = 27.1 bits (57), Expect = 3.4 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 385 RARVSNNGSVSCIKRLDISTPISMQLDNWPNDMQTCTFKFGSRMHN 522 RA +++ + +KR DI + DNW ND+ C + G +H+ Sbjct: 588 RAVIAHMLELDPVKRYDIHRVFA---DNWINDISMCHMENGKVIHS 630 >SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 26.6 bits (56), Expect = 4.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 285 FPCVPTQSFVDPIHLKICQYPHGGL 211 F +P Q+F H+++C YP GG+ Sbjct: 150 FKEIPQQNFT---HVRLCMYPDGGI 171 >SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 411 Score = 26.6 bits (56), Expect = 4.5 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = +1 Query: 397 SNNGSVSCIKRLDISTPISMQLDNWPNDMQTCTFKFGSRMHNSDEMDFV--IDKRIYSMF 570 SN+ +++C LD+ LD D+ T TFK M F+ + ++S Sbjct: 279 SNDSNINCSTCLDVDCQHLHSLDTHSLDISTHTFKLPPLMSKEVFQQFLQWVRHTLWSCL 338 Query: 571 ESG 579 E G Sbjct: 339 EEG 341 >SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.8 bits (54), Expect = 7.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 469 WPNDMQTCTFKFGSRMHNSDEMDFVIDKRIYSMFES 576 WP D+ T FG+ D D + D+ +Y M ++ Sbjct: 105 WPQDLYTLNPHFGTEQDLIDLADALHDRGMYLMVDT 140 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,009,269 Number of Sequences: 5004 Number of extensions: 58810 Number of successful extensions: 145 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -