BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C18 (916 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0366 - 13102147-13102281,13102560-13102739,13102791-131029... 32 0.55 11_06_0411 - 23230580-23230795,23231407-23231862,23232142-232321... 30 2.2 12_01_0424 - 3346402-3346875 29 3.9 08_02_1291 + 25930056-25930067,25930289-25930334,25930434-259305... 29 3.9 09_04_0031 + 13946692-13946774,13947007-13948012 29 6.8 01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668,298... 29 6.8 09_04_0028 - 13928542-13929538,13929736-13929818 28 9.0 07_03_0809 - 21669632-21669637,21669871-21670131,21670573-216707... 28 9.0 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 28 9.0 >05_03_0366 - 13102147-13102281,13102560-13102739,13102791-13102992, 13104385-13104575 Length = 235 Score = 32.3 bits (70), Expect = 0.55 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -3 Query: 332 HQPSAAAPFPCVPTQSFVDPIHLKICQYPHGGLGLTNVSMSQM-QGQVDYDFGVGG 168 H P AAA P VP++ P L + GG GL S S + G + D G+GG Sbjct: 7 HSPRAAAAAPSVPSR-LPRPFLLSLSSPSRGGSGLVAASASAVAAGGSEGDGGIGG 61 >11_06_0411 - 23230580-23230795,23231407-23231862,23232142-23232195, 23232251-23232367 Length = 280 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 Query: 230 VRVHRADTGRSSNELDRQTTELERRGMGLQHLAGVLGTL 346 V+ H + R S EL+RQ ELER+G L+ G L + Sbjct: 89 VQRHGEELERQSRELERQREELERQGRELKMKDGKLNRM 127 >12_01_0424 - 3346402-3346875 Length = 157 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 482 AGLDXWPXEXADLXGSLRVRGWP 550 AG+D WP AD+ + V GWP Sbjct: 46 AGVDGWPKAPADVAPNAGVDGWP 68 >08_02_1291 + 25930056-25930067,25930289-25930334,25930434-25930546, 25930645-25930930,25931357-25931421,25931642-25931693, 25931774-25931883,25932611-25932641,25932853-25933004, 25934622-25934840 Length = 361 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 245 HGGLGLTNVSMSQMQGQVDYDFGVGGRLPI 156 +GG L ++Q G Y +G GGRLP+ Sbjct: 100 YGGPALPRYGIAQFPGGSGYPYGYGGRLPM 129 >09_04_0031 + 13946692-13946774,13947007-13948012 Length = 362 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 307 NGAAALGWCPRNACGGLTWYCXTR 378 NG AALGW R+ G L+ + TR Sbjct: 4 NGTAALGWAARDTSGHLSPFSFTR 27 >01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668, 2986798-2986893,2987003-2987042,2987760-2987887 Length = 305 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -2 Query: 411 RGERSPRRXXHPRXAVPRQASTSVPRTPAKCCSPIPLRSNSVVCRSNSFEDLPVSA 244 R RSPRR P R + + R+PA S P+R++S + D+ +A Sbjct: 224 RDSRSPRRSASPPNGRNRSPTPNASRSPAPRDSRSPMRADSRSPADHERRDMSTAA 279 >09_04_0028 - 13928542-13929538,13929736-13929818 Length = 359 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 307 NGAAALGWCPRNACGGLTWYCXTR 378 +G AALGW R+A G L+ + TR Sbjct: 4 DGTAALGWAARDASGHLSPFSFTR 27 >07_03_0809 - 21669632-21669637,21669871-21670131,21670573-21670752, 21671458-21672819 Length = 602 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 117 SLSLMIDSLLATYDRESPPDSKIVVNLTLHLRHANIRESESTVRILADLQMN 272 +L +D L+ YD+ PPDS+ V HA + +R+L + +N Sbjct: 160 NLWTQVDILILRYDK--PPDSRFVQEALAAHAHATEGSETTAIRLLEVISLN 209 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = -3 Query: 359 VRPPQAFRGHQPSAAAPFPCVPTQSFVDPIHLKICQYPHGGLGLTNVSMSQMQGQV 192 ++PP H + AP P +P+ S P++ + PH S +QM Q+ Sbjct: 551 LQPPAHMLPHAQGSRAPLPQLPSMSGPPPVNPPLPPMPHPMAMQVQGSSNQMMPQM 606 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,982,816 Number of Sequences: 37544 Number of extensions: 330468 Number of successful extensions: 979 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2600672280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -