BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C14 (861 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 4.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 4.8 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 8.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 8.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 8.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 8.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 8.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 8.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 8.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 8.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 8.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 8.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 8.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 8.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 8.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 8.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 8.4 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 484 PSSSRITIGGLALMHQATLPCDLGYINPIIKSPIP 588 PS++R +G +A + PC + P+ P+P Sbjct: 450 PSATRYDLGAVATVGTTVAPC---FEEPLPSLPLP 481 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHDFQH 226 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 196 SKKYATSSNSLRSRTHGFQH 215 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 196 SKKYATSSNSLRSRTHGFQH 215 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 196 SKKYATSSNSLRSRTHGFQH 215 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 SRPYASSHPPLRSRLHQPDH 572 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,744 Number of Sequences: 438 Number of extensions: 4873 Number of successful extensions: 31 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -