BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C14 (861 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family... 34 0.11 At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 32 0.56 At5g09730.1 68418.m01127 glycosyl hydrolase family 3 protein bet... 30 2.3 At1g50090.1 68414.m05619 aminotransferase class IV family protei... 28 7.0 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 28 9.2 At4g02070.1 68417.m00277 DNA mismatch repair protein MSH6-1 (MSH... 28 9.2 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 28 9.2 >At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family protein identical to hydroxyproline-rich glycoprotein [Arabidopsis thaliana] gi|9293881|dbj|BAB01784 Length = 532 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = +3 Query: 522 YASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPG 665 Y SS P +RS H P + P + PP T + S P PY E PG Sbjct: 441 YVSSFPFIRSPSHSPQYASPAAYPSPPTTVYSNRSPP-YPYSPEIIPG 487 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +3 Query: 483 PFILSHYYWRSRPYASSHPPLRSR---LHQPDHQIPDSIHQPPQT*HPFP 623 PF +S +RP+ +S PP S+ + QP + QPP T P P Sbjct: 488 PFSMSQPSSTARPFPASQPPAASKSFPISQPPTTSKPFVSQPPNTSKPMP 537 Score = 27.9 bits (59), Expect = 9.2 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Frame = +3 Query: 468 QCAGHPFILSHYYWRSRPYASSHPPLRSRLHQPDHQIPDS-----IHQPPQT*HPFPSIP 632 Q A +PF +S S+P++ S P +R P Q P + I QPP T PF S P Sbjct: 471 QPASNPFPVSQPRPNSQPFSMSQPSSTARPF-PASQPPAASKSFPISQPPTTSKPFVSQP 529 >At5g09730.1 68418.m01127 glycosyl hydrolase family 3 protein beta-xylosidase, Hypocrea jecorina, EMBL:Z69257 Length = 773 Score = 29.9 bits (64), Expect = 2.3 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = +2 Query: 548 ISATSTRSSNPRFHTPTTPDLTSISINPLNAVLXGVRARG*SL--RLSSEAPSAYLTPSS 721 IS S S+P F T + + + NA L ++AR L RL+ E +LT + Sbjct: 22 ISEQSNNQSSPVFACDVTGNPSLAGLRFCNAGL-SIKARVTDLVGRLTLEEKIGFLTSKA 80 Query: 722 LGMAKXGSPPY 754 +G+++ G P Y Sbjct: 81 IGVSRLGIPSY 91 >At1g50090.1 68414.m05619 aminotransferase class IV family protein contains Pfam profile: PF01063 aminotransferase class IV Length = 367 Score = 28.3 bits (60), Expect = 7.0 Identities = 21/83 (25%), Positives = 37/83 (44%) Frame = +1 Query: 310 VQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVDLCWTTADVTVEGVNVLATPS 489 V+S N S ++K +A V+F A + K V C ++ + N+++TP Sbjct: 201 VKSCTNYSPVVKSLIEAKSSGFSDVLFLDAATGKNIEEVSTC----NIFILKGNIVSTPP 256 Query: 490 SSRITIGGLALMHQATLPCDLGY 558 +S + G+ L D+GY Sbjct: 257 TSGTILPGITRKSICELARDIGY 279 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +3 Query: 507 WRSRPYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGVK 671 ++ P +PP + P+H P PPQ +P P I P +++ P +K Sbjct: 137 FKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYP-PPIKKYPPPEKYPPPIK 190 >At4g02070.1 68417.m00277 DNA mismatch repair protein MSH6-1 (MSH6-1) (AGAA.3) identical to SP|O04716 DNA mismatch repair protein MSH6-1 (AtMsh6-1) cress] {Arabidopsis thaliana} Length = 1324 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +1 Query: 313 QSLPNVSSIIKGYRDAY 363 QSLPN+SS IK ++DA+ Sbjct: 854 QSLPNISSSIKYFKDAF 870 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 519 PYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFP 623 P S PP+ S P H P +H PP H P Sbjct: 673 PVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 707 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +3 Query: 519 PYASSHPPLRSRLHQPDHQIPDSIHQPPQT*H-PFPSIP*TPYXKEFAPGVKASV 680 P S PP+ S P H P +H PP H P P + P F+P A + Sbjct: 695 PVHSPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPI 748 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 519 PYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFP 623 P S PP+ S P H P +H PP H P Sbjct: 755 PVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 789 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,153,565 Number of Sequences: 28952 Number of extensions: 365275 Number of successful extensions: 1171 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1158 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -