BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C13 (841 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-P... 31 2.6 BT011483-1|AAR99141.1| 913|Drosophila melanogaster RE03641p pro... 29 7.9 AY268106-1|AAP03646.1| 913|Drosophila melanogaster painless pro... 29 7.9 AE013599-3983|AAF47293.1| 913|Drosophila melanogaster CG15860-P... 29 7.9 >AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-PA protein. Length = 1333 Score = 30.7 bits (66), Expect = 2.6 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -3 Query: 761 RSAECMNQMSETAVXLVLSSITIATTSHQ*G 669 + EC Q+S ++ LV+S+IT+AT +H G Sbjct: 701 QQCECHAQVSIASLLLVISAITVATNTHDYG 731 >BT011483-1|AAR99141.1| 913|Drosophila melanogaster RE03641p protein. Length = 913 Score = 29.1 bits (62), Expect = 7.9 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 372 SKSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*Q-EVPE-KLPQ 500 SK K K LIQ+F H + + +YR+ ++ Q + PE KLP+ Sbjct: 166 SKVKAGKKELIQLFLDHPELDIDSYRNGEVRRLLQAQFPELKLPE 210 >AY268106-1|AAP03646.1| 913|Drosophila melanogaster painless protein. Length = 913 Score = 29.1 bits (62), Expect = 7.9 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 372 SKSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*Q-EVPE-KLPQ 500 SK K K LIQ+F H + + +YR+ ++ Q + PE KLP+ Sbjct: 166 SKVKAGKKELIQLFLDHPELDIDSYRNGEVRRLLQAQFPELKLPE 210 >AE013599-3983|AAF47293.1| 913|Drosophila melanogaster CG15860-PA protein. Length = 913 Score = 29.1 bits (62), Expect = 7.9 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 372 SKSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*Q-EVPE-KLPQ 500 SK K K LIQ+F H + + +YR+ ++ Q + PE KLP+ Sbjct: 166 SKVKAGKKELIQLFLDHPELDIDSYRNGEVRRLLQAQFPELKLPE 210 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,568,150 Number of Sequences: 53049 Number of extensions: 757025 Number of successful extensions: 1818 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1818 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4003789140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -