BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C07 (837 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0414 + 17892133-17893590 29 4.6 03_05_0183 - 21681673-21682524 29 4.6 01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157... 29 4.6 >07_03_0414 + 17892133-17893590 Length = 485 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = -3 Query: 745 QMSETAVXLVLSSITIATTSHQ*GKTNLSHDGLIPAHVPF*WVNNPTL-GEFCFAMIGRA 569 Q + V + L S+T+ + T H GL+ A PF WV P + G A + A Sbjct: 279 QADGSVVYVSLGSLTVISLEQF---TEFLH-GLVAAGYPFLWVLRPDMVGASQSAALREA 334 Query: 568 DIEGSKSNVAMNAWLPQ 518 KS + W PQ Sbjct: 335 VAAAGKSKARVVEWAPQ 351 >03_05_0183 - 21681673-21682524 Length = 283 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 525 SQAFIATLLFDPSMSALPIIAKQNSPS 605 SQAF A LL D + +A+P++ Q P+ Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPA 255 >01_07_0197 + 41912207-41912652,41913226-41913800,41913828-41915748, 41915836-41916049,41916143-41916394,41916469-41916528, 41916646-41916776,41916898-41917012,41917084-41917239 Length = 1289 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 464 YKEFLARG-ARKVTTGITGLWQPSVHSDVAF*SFDVG 571 YK F A G RKV GIT + PS+ D+AF S +G Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSAALG 669 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,223,575 Number of Sequences: 37544 Number of extensions: 411450 Number of successful extensions: 833 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -