BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_C05 (878 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 24 5.3 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 24 7.0 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 9.3 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 9.3 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 9.3 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 9.3 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 24.2 bits (50), Expect = 5.3 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -2 Query: 688 KRPNLQTICRSQSLQQTVRQVSPDRLDTQPPGGTIQSP 575 KR N T+C + + V +LD+ P G +I +P Sbjct: 42 KRGNRITVCSYSATEAIVCCPQSQQLDSPPSGFSIPTP 79 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 23.8 bits (49), Expect = 7.0 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 Query: 544 SSSGQRYALGPEIVSCRLEAACRVGQGSPGG 636 + SGQ + G I L AAC + Q G Sbjct: 156 AGSGQAFLAGDRISIADLSAACEIEQAKIAG 186 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 9.3 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 488 VEDVDADALRELVEYAYTGRVRV 556 + DV+ + +R L+++ Y G V V Sbjct: 119 LRDVEVNEMRALLDFMYQGEVNV 141 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 9.3 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 488 VEDVDADALRELVEYAYTGRVRV 556 + DV+ + +R L+++ Y G V V Sbjct: 119 LRDVEVNEMRALLDFMYQGEVNV 141 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 9.3 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 488 VEDVDADALRELVEYAYTGRVRV 556 + DV+ + +R L+++ Y G V V Sbjct: 71 LRDVEVNEMRALLDFMYQGEVNV 93 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 9.3 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 488 VEDVDADALRELVEYAYTGRVRV 556 + DV+ + +R L+++ Y G V V Sbjct: 119 LRDVEVNEMRALLDFMYQGEVNV 141 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,628 Number of Sequences: 2352 Number of extensions: 17972 Number of successful extensions: 26 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -