BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B24 (890 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0373 + 2783596-2784933 31 0.93 06_03_1310 + 29238644-29240260 31 0.93 01_04_0116 + 16189250-16189411,16189577-16190104 31 1.6 01_01_0448 - 3332238-3332330,3332414-3332481,3332570-3332618,333... 30 2.1 02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514,143... 29 3.8 04_01_0041 - 464695-464850,467485-469029 29 6.6 01_05_0227 - 19512866-19514983 29 6.6 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 28 8.7 07_03_0525 - 19044978-19045508 28 8.7 03_01_0606 - 4461646-4462623 28 8.7 02_05_0788 + 31758119-31758384,31758482-31758634,31759385-317595... 28 8.7 >07_01_0373 + 2783596-2784933 Length = 445 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 92 EEEKALTKEGMAEAAETXKGTISSMNRS 9 E+++ LTK G + +ET KG++ S++RS Sbjct: 151 EQQQQLTKSGCSSTSETSKGSVLSLSRS 178 >06_03_1310 + 29238644-29240260 Length = 538 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +1 Query: 571 HQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEAPSAYLTPLVTGHG*RGFAP 750 H+ P H PP+ P P P +P P PP SE+P + + P + G +P Sbjct: 381 HRSPLPHHMPPRRTPPTPPPPSSPTPSHLPP--PPPTYSESPKSSMPPSTSPPSSHGASP 438 >01_04_0116 + 16189250-16189411,16189577-16190104 Length = 229 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 750 PYFQVNDESQASRLIXRHSRILGSPPPITP-S*KXXXGHNQPSST 881 P VN+ SQ L+ H SPPP+ P S H++PS+T Sbjct: 4 PSLTVNESSQPPPLVVSHRLPSFSPPPLPPVSGTALCRHHRPSAT 48 >01_01_0448 - 3332238-3332330,3332414-3332481,3332570-3332618, 3332716-3332798,3332900-3333023,3333389-3333486, 3333555-3333634,3333712-3333782,3333872-3333953, 3334158-3334237,3334365-3334416,3334843-3334958 Length = 331 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = +3 Query: 543 LAILATSTRSSNPRFHTPTTPDLTSISINPLNAVLXGVRAGVKASVVIRGSISVSHP 713 +A +T+TR S PR H PTTP S + + +RA +V+ G+ + HP Sbjct: 1 MAASSTATRLSPPRLHAPTTP---SPHLPLRRSRFSPLRAAKLEAVLTIGTHLIPHP 54 >02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514, 1438627-1438696,1439264-1439407,1439771-1439837, 1439970-1440019,1440386-1440559,1440881-1440934, 1441008-1441112 Length = 330 Score = 29.5 bits (63), Expect = 3.8 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = +1 Query: 283 TETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSL--KIPVTVDLCWTTADVT 456 TE +N V V L SS GY D + ++ V + K+ V +D TAD++ Sbjct: 167 TEAGANRVLVCDLH--SSQAMGYFDIPVDHVYGQVMNLIGDVRGKVAVMMDDMIDTADIS 224 Query: 457 VEGVNVLATPSSSRITIGGLALMHQ 531 + +N+L P G L+HQ Sbjct: 225 LPNINILMKPIKLGTIAKGAELLHQ 249 >04_01_0041 - 464695-464850,467485-469029 Length = 566 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +1 Query: 244 IIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPS-APSLKIPV 420 +I R + D++ T +SN + V +LP VSS + Y D ++ + P P ++ V Sbjct: 40 LISVFRPFTDVSLTLCRSNYIGVTNLPIVSSECEAYYDDFVSGADFTARPQVVPPWRLAV 99 Query: 421 TVD 429 +D Sbjct: 100 PLD 102 >01_05_0227 - 19512866-19514983 Length = 705 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 461 STVTSAVVQQRSTVTGILRLGAEGKTTASRL 369 S +T + +QQ + ++ LG GKTT ++L Sbjct: 18 SKLTESSIQQNIKIVSVIGLGGSGKTTLAKL 48 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 553 WLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPP 678 WL+ P P PP + P P +P PY + +P PP Sbjct: 12 WLNSPLWSAP-----PPSSSSPSPPVPPDPYGADLSPPPPPP 48 >07_03_0525 - 19044978-19045508 Length = 176 Score = 28.3 bits (60), Expect = 8.7 Identities = 27/86 (31%), Positives = 40/86 (46%) Frame = +3 Query: 528 SSHPPLAILATSTRSSNPRFHTPTTPDLTSISINPLNAVLXGVRAGVKASVVIRGSISVS 707 S P +AT+ R + RF TT D T+ + A R V+ VV+ + S S Sbjct: 21 SRRPERVTIATTGRDAARRF--ATTADSTAAAA----AAAPPSRERVRRRVVLPPASS-S 73 Query: 708 HPPRHWTWLKGVRPPYFQVNDESQAS 785 + PRH T L P+ + N+E A+ Sbjct: 74 YRPRHATALDVKWSPWIENNEERSAA 99 >03_01_0606 - 4461646-4462623 Length = 325 Score = 28.3 bits (60), Expect = 8.7 Identities = 23/85 (27%), Positives = 33/85 (38%) Frame = +3 Query: 480 HPFILSHYYWRSRPYASSHPPLAILATSTRSSNPRFHTPTTPDLTSISINPLNAVLXGVR 659 HPF H++WR P PP A A S F LT+ + + + V+ Sbjct: 168 HPFATPHWHWRLLP----SPPFAFTADDALDSIRNFFQDDDDFLTAYTAVGGSCIWMTVQ 223 Query: 660 AGVKASVVIRGSISVSHPPRHWTWL 734 + V A+ G+ S WT L Sbjct: 224 STVAAAA---GTYSFDTSTATWTKL 245 >02_05_0788 + 31758119-31758384,31758482-31758634,31759385-31759509, 31759650-31759678,31760943-31761008,31761059-31761125, 31761226-31761370,31761404-31761451,31762014-31762182, 31762645-31762779,31762858-31763064,31763608-31763735, 31763815-31763866,31764046-31764060,31764502-31764609 Length = 570 Score = 28.3 bits (60), Expect = 8.7 Identities = 21/86 (24%), Positives = 36/86 (41%) Frame = +1 Query: 235 QRLIIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKI 414 Q I + ++ L N TV + N + GY+ +N+ + PSLK Sbjct: 198 QVFCIVLEMFFYQLLQLLKVPNEKTVNVIENAIQTLPGYQPPKHINIGEYISSHVPSLK- 256 Query: 415 PVTVDLCWTTADVTVEGVNVLATPSS 492 D C T ++ +EG++ L S+ Sbjct: 257 ----DFCEPTVEM-LEGMSALKALST 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,399,733 Number of Sequences: 37544 Number of extensions: 577106 Number of successful extensions: 1600 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1600 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -