BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B23 (920 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05130.1 68418.m00544 SNF2 domain-containing protein / helica... 32 0.61 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 28 7.6 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 28 7.6 >At5g05130.1 68418.m00544 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 862 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/69 (21%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = -1 Query: 218 LKCRVRLTTILESGGDSRSYVARSESIM-RDSDVAFSHSAALAIAQVRRNGNKNNISRRH 42 + C++ + LE+ +S ++R ++ +SD +F S A+ + + NG+K ++ + Sbjct: 126 IPCQIHVFAKLEASSTVKSTISRGGLVLISESDTSFGLSEAVVVKEQMGNGDKRSVDKIF 185 Query: 41 FMTTDLLKL 15 + + +KL Sbjct: 186 KLVDENVKL 194 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 421 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 332 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 421 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 332 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,801,303 Number of Sequences: 28952 Number of extensions: 318424 Number of successful extensions: 864 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2188225800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -