BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B17 (894 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 25 1.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 3.2 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 5.6 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 5.6 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 7.5 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 24.6 bits (51), Expect = 1.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 514 TRGSRPLVEPGLNPMSSISPY 576 T R P L+PMSS+ PY Sbjct: 468 TSSKRQRTSPQLSPMSSLPPY 488 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -1 Query: 525 AATGLGLY--RRIVLRNPSPLSTPDVSNTDRRCSQNISWST 409 AA G G + ++ PSP STP T R + N ++S+ Sbjct: 58 AAVGKGFHPWKKSPQGAPSPSSTPSSLPTQRTSTSNPTYSS 98 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +2 Query: 218 NCLHDYFDIKHSPATLDCYHRPDLHQQEGNGTSS 319 N +H D + DC++ ++QE TSS Sbjct: 656 NDVHSIVDDSDVGPSGDCFYENKFYRQEAQWTSS 689 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -2 Query: 608 NIPRRHGMNIAYGEIEDIGFN 546 N+P +++AY I + FN Sbjct: 162 NLPELEDLDLAYNSISSLDFN 182 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 7.5 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = -1 Query: 579 CVRGNRRHW 553 C++GN +HW Sbjct: 187 CLKGNAKHW 195 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,870 Number of Sequences: 336 Number of extensions: 5240 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24823920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -