BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B13 (922 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2XWK6 Cluster: Nicotinic acetylcholine receptor subuni... 34 4.4 >UniRef50_Q2XWK6 Cluster: Nicotinic acetylcholine receptor subunit type G; n=1; Lymnaea stagnalis|Rep: Nicotinic acetylcholine receptor subunit type G - Lymnaea stagnalis (Great pond snail) Length = 618 Score = 34.3 bits (75), Expect = 4.4 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%) Frame = +2 Query: 119 LMIDSLLATYDRDSPPELQNRSQPDPAF*YMLTFVSP----SPPLRIQADLQMNWIDQRL 286 L+++ LLA Y R S P + F L +S + L I L+ W+D+RL Sbjct: 90 LLMERLLARYHRYSRPVMNASLSVQVKFGLTLVQISDMDEVNQVLTINVWLEQEWVDERL 149 Query: 287 TWNAGEW 307 TW+ E+ Sbjct: 150 TWSPKEY 156 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,869,723 Number of Sequences: 1657284 Number of extensions: 8588342 Number of successful extensions: 22070 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22067 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 84441173866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -