Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_B13
         (922 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2XWK6 Cluster: Nicotinic acetylcholine receptor subuni...    34   4.4  

>UniRef50_Q2XWK6 Cluster: Nicotinic acetylcholine receptor subunit
           type G; n=1; Lymnaea stagnalis|Rep: Nicotinic
           acetylcholine receptor subunit type G - Lymnaea
           stagnalis (Great pond snail)
          Length = 618

 Score = 34.3 bits (75), Expect = 4.4
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%)
 Frame = +2

Query: 119 LMIDSLLATYDRDSPPELQNRSQPDPAF*YMLTFVSP----SPPLRIQADLQMNWIDQRL 286
           L+++ LLA Y R S P +         F   L  +S     +  L I   L+  W+D+RL
Sbjct: 90  LLMERLLARYHRYSRPVMNASLSVQVKFGLTLVQISDMDEVNQVLTINVWLEQEWVDERL 149

Query: 287 TWNAGEW 307
           TW+  E+
Sbjct: 150 TWSPKEY 156


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 510,869,723
Number of Sequences: 1657284
Number of extensions: 8588342
Number of successful extensions: 22070
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 21434
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22067
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 84441173866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)