BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B11 (892 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 27 3.6 SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 27 4.7 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 26 8.3 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.1 bits (57), Expect = 3.6 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 583 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIXMFSTHRDCESTAY 717 Y+C + +S G L SED ++ W K GLI F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 756 WHXLVKTLYXKGSIGRAFAVPMRTEH 679 +H + + L GSI FAVP++ EH Sbjct: 398 FHGIAELLEILGSIINGFAVPLKEEH 423 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.8 bits (54), Expect = 8.3 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 700 SPYAY*TXGSSQLLPFCSTRGF 635 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,384,335 Number of Sequences: 5004 Number of extensions: 71196 Number of successful extensions: 143 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -