Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_B11
         (892 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB208890-1|BAD92127.1|  443|Homo sapiens potassium voltage-gated...    31   7.4  

>AB208890-1|BAD92127.1|  443|Homo sapiens potassium voltage-gated
           channel KQT-like protein 3 variant protein.
          Length = 443

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 2/70 (2%)
 Frame = -2

Query: 534 RGSFKRRRAFPPRHHSARLERNTVRP-PI-LSTAHRFRPTE*VMKQ*K*WFSSDDRAKRS 361
           RGS  + + F P +  A  E  +  P P+ L+   RFR T   MK    W SS+  A  S
Sbjct: 362 RGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFR-TAFRMKAYAFWQSSEGNAFLS 420

Query: 360 PTYATPLMSP 331
           P+ + PL+ P
Sbjct: 421 PSLSLPLLPP 430


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,351,514
Number of Sequences: 237096
Number of extensions: 2886020
Number of successful extensions: 9636
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9254
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9636
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11437206932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)