BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B08 (828 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC014226-1|AAH14226.2| 670|Homo sapiens MFHAS1 protein protein. 31 3.9 AB016816-1|BAA74737.1| 1052|Homo sapiens MASL1 protein. 31 3.9 >BC014226-1|AAH14226.2| 670|Homo sapiens MFHAS1 protein protein. Length = 670 Score = 31.5 bits (68), Expect = 3.9 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 666 GHRXKCXPPSIPILSEGCRDTPWNCGAMTKGSXFAV 559 G + KC PPS P +S+G T W A ++G F V Sbjct: 59 GDKEKCYPPSPPPVSKGIEVTSWTADA-SRGLRFIV 93 >AB016816-1|BAA74737.1| 1052|Homo sapiens MASL1 protein. Length = 1052 Score = 31.5 bits (68), Expect = 3.9 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 666 GHRXKCXPPSIPILSEGCRDTPWNCGAMTKGSXFAV 559 G + KC PPS P +S+G T W A ++G F V Sbjct: 441 GDKEKCYPPSPPPVSKGIEVTSWTADA-SRGLRFIV 475 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,835,338 Number of Sequences: 237096 Number of extensions: 2362984 Number of successful extensions: 5197 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5197 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10370898348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -