BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B07 (903 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2GQA3 Cluster: Putative uncharacterized protein; n=1; ... 35 2.5 UniRef50_UPI0000D55EDD Cluster: PREDICTED: similar to CG11822-PA... 34 5.7 >UniRef50_Q2GQA3 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 558 Score = 35.1 bits (77), Expect = 2.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 326 DTSQVXQPHSPCVPTQSXXDPIHLKICLYSHGGLGLTNVSMS 201 DT+ P +PC PT +P+ ++ YS GG +T V +S Sbjct: 355 DTTDTKLPTTPCPPTTPADEPVAVQGYAYSGGGRAITRVDVS 396 >UniRef50_UPI0000D55EDD Cluster: PREDICTED: similar to CG11822-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG11822-PA, isoform A - Tribolium castaneum Length = 438 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/46 (30%), Positives = 28/46 (60%) Frame = +3 Query: 168 SKIVVNLTLHLRHANIRESESTVRIQADLQMNWIXXRLSWNAXXVG 305 +K+V LT+ RH + E +ST+ + + ++++W +L WN+ G Sbjct: 64 TKVVFGLTI--RHIELNEFKSTLVVHSWIRLSWKDEKLQWNSTNYG 107 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,876,422 Number of Sequences: 1657284 Number of extensions: 7918145 Number of successful extensions: 17052 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17048 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 81981722200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -