BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B05 (893 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-... 31 1.0 At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 29 4.2 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 4.2 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 5.5 At1g64340.1 68414.m07291 hypothetical protein 28 7.3 At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / halo... 28 9.6 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 9.6 At3g62370.1 68416.m07006 expressed protein 28 9.6 At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ... 28 9.6 >At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-binding protein GUF1 - Saccharomyces cerevisiae, PIR:S50374 Length = 661 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -3 Query: 300 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 154 LG +H PA +I+R P PP +S +++++F E +CY S V Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVV 277 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 170 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 60 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 440 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 553 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -2 Query: 403 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 287 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At1g64340.1 68414.m07291 hypothetical protein Length = 265 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 515 DCESTAYRSFSIKSF*QEVPEKLPQGITGLWQPSVHS 625 DCEST Y SF + SF +++ + + P + S Sbjct: 124 DCESTLYDSFELNSFNRQLNSAISSSARSMSMPHLSS 160 >At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase familiy protein similar to SP|O14072 Cation-transporting ATPase 4 (EC 3.6.3.-) {Schizosaccharomyces pombe}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00702: haloacid dehalogenase-like hydrolase Length = 1179 Score = 27.9 bits (59), Expect = 9.6 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -2 Query: 574 WHLLLKTLYTKGSIG-RAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTD 404 +H+L+ L+T S+ + F + +DQA C P + S E+ H R +TD Sbjct: 61 FHILV-LLFTTWSVDFKCFVQFSKVNSIDQADACKVTPAKFSGSKEVVPLHFRSQMTD 117 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 264 DRAPLPPNRVSNETMKVVVFQRRSRET 184 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 388 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 293 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 >At1g67340.1 68414.m07665 zinc finger (MYND type) family protein / F-box family protein Length = 379 Score = 27.9 bits (59), Expect = 9.6 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -3 Query: 315 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 178 S LC LG+ R PAD I+ L R+ M +V R S + I+ Sbjct: 54 SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,177,538 Number of Sequences: 28952 Number of extensions: 407520 Number of successful extensions: 1132 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1132 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -