BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B02 (788 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) 212 3e-55 SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) 208 3e-54 SB_55406| Best HMM Match : DUF1534 (HMM E-Value=0.45) 29 5.7 SB_25655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_14298| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_54689| Best HMM Match : DUF1525 (HMM E-Value=6.3) 28 9.9 SB_36686| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) Length = 347 Score = 212 bits (517), Expect = 3e-55 Identities = 92/125 (73%), Positives = 109/125 (87%) Frame = +1 Query: 22 LSSSMSHRKFSAPRHGSMGFYPKKRSRRHRGKVKAFPKDDPSKSVHLTAFIGYKAGMTHV 201 L MSHRKF APRHGS+GF P+KR +RHRGKVK+FPKDD + HLTAFIG+KAGMTH+ Sbjct: 44 LEPKMSHRKFEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHI 103 Query: 202 VREPDRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEDCRR 381 +RE ++PGSK+NKKE VEAVTIIETPPM+ VGVVGYIETP G+R L T+WAEH+SE+C+R Sbjct: 104 LREVEKPGSKLNKKEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKR 163 Query: 382 RFYKN 396 RFYKN Sbjct: 164 RFYKN 168 Score = 48.0 bits (109), Expect = 9e-06 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +1 Query: 580 WQDELGRKSIEKDFKKMIRYCSVVRVIXHTQ 672 W D+ G+KSIE+DF M +YC V+RVI HTQ Sbjct: 184 WADDDGKKSIEEDFNTMKKYCKVIRVICHTQ 214 >SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) Length = 338 Score = 208 bits (509), Expect = 3e-54 Identities = 90/120 (75%), Positives = 107/120 (89%) Frame = +1 Query: 37 SHRKFSAPRHGSMGFYPKKRSRRHRGKVKAFPKDDPSKSVHLTAFIGYKAGMTHVVREPD 216 SHRKF APRHGS+GF P+KR +RHRGKVK+FPKDD + HLTAFIG+KAGMTH++RE + Sbjct: 1 SHRKFEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHILREVE 60 Query: 217 RPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEDCRRRFYKN 396 +PGSK+NKKE VEAVTIIETPPM+ VGVVGYIETP G+R L T+WAEH+SE+C+RRFYKN Sbjct: 61 KPGSKLNKKEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKRRFYKN 120 Score = 73.7 bits (173), Expect = 2e-13 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 580 WQDELGRKSIEKDFKKMIRYCSVVRVIXHTQMKLLKQRQKKAHIME 717 W D+ G+KSIE+DF M +YC V+RVI HTQ KLLK RQKKAHIME Sbjct: 136 WADDDGKKSIEEDFNTMKKYCKVIRVICHTQQKLLKMRQKKAHIME 181 >SB_55406| Best HMM Match : DUF1534 (HMM E-Value=0.45) Length = 248 Score = 28.7 bits (61), Expect = 5.7 Identities = 31/112 (27%), Positives = 39/112 (34%), Gaps = 4/112 (3%) Frame = +1 Query: 4 WHFSLR---LSSSMSHRKFSAPRHGSMGFYPKKRSRRHRGK-VKAFPKDDPSKSVHLTAF 171 W SLR S + S+R + R GF SR R + + DP S Sbjct: 129 WRRSLRRQQASFAHSNRGMAHGRRRGRGFGFGNASRHERSSALPGYSTHDPRHSNDRPPR 188 Query: 172 IGYKAGMTHVVREPDRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHG 327 EP P S + + + A TI TPP V E PHG Sbjct: 189 GDSIVTQLEGPNEPPPPYSTLERSPVTIADTIDITPPSYEEAVQSSSEEPHG 240 >SB_25655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 43 RKFSAPRHGSMGFYPKKRSRRHRGK-VKAFPKDDPSKSVH 159 R+F P+ G +G Y ++ R H GK + PK +P + + Sbjct: 145 RRFWMPKFGHVGPYSEQVKRDHDGKIIDIIPKGNPMEDAY 184 >SB_14298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 427 NKALIFREESSFCRSDVDSLQTYAP-PRQSTER 332 N A+I + +C D+ Q YAP RQ++ R Sbjct: 392 NDAVILKRRECYCEKDLSKTQLYAPSDRQASNR 424 >SB_54689| Best HMM Match : DUF1525 (HMM E-Value=6.3) Length = 298 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +1 Query: 82 YPKKRSRRHRGKVKAFPKDDPSKSVHLTAFIGYKAGMTHVVREPD 216 +P ++ + +V +P D +H+ AF+G+K+ T + P+ Sbjct: 70 HPSSQNVKTSLRVPIYPPKDIQVDLHIKAFVGHKSRFTMYIPCPE 114 >SB_36686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 274 TPPMVCVGVVGYIETPHGLRAL-LTVWAEHMSEDCRRRFY 390 TP +C+G GY+ T L+ L LTV M E + +++ Sbjct: 301 TPGRLCIGSYGYVATQQFLQLLRLTVLPPVMIEKAKNQYH 340 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,741,233 Number of Sequences: 59808 Number of extensions: 512499 Number of successful extensions: 1161 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1161 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -