BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_B01 (850 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 9.0 At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ... 28 9.0 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 414 DRAPLPPNRVSNETMKVVVFQRRSRET 334 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At1g67340.1 68414.m07665 zinc finger (MYND type) family protein / F-box family protein Length = 379 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -2 Query: 465 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 328 S LC LG+ R PAD I+ L R+ M +V R S + I+ Sbjct: 54 SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,416,479 Number of Sequences: 28952 Number of extensions: 239871 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -