BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A24 (936 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 25 0.64 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 7.9 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 25.4 bits (53), Expect = 0.64 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +1 Query: 295 KAYTQYRLNSPKEALQTVDSAPELTPALKELRAQILYRLEQYQDCY 432 KAY L++ E L + PEL P + A Y+ ++YQ Y Sbjct: 416 KAYGAGLLSAYGELLHALSDKPELRPFEPAVTAVQPYQDQEYQPIY 461 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -2 Query: 389 LNSFKAGVNSGALSTVCSASLGELR 315 +NSF SG L +C ++ + R Sbjct: 241 VNSFSCSCPSGTLGYICEINVDDCR 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,729 Number of Sequences: 336 Number of extensions: 3897 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26271982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -