BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A19 (861 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 3.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 7.2 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 76 GSQISTGSNNPNKDVEVSSPPDDTVS 153 GS +S N PNK PP+ +S Sbjct: 55 GSLLSPSGNTPNKSSTSPYPPNHPLS 80 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/37 (27%), Positives = 14/37 (37%) Frame = +1 Query: 424 CHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLNL 534 C+W PN T + D W S+ L+L Sbjct: 18 CNWSSGPNATLQSSACTDDLSSCWSEDMGSFSLPLDL 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,186 Number of Sequences: 336 Number of extensions: 4076 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -