BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A13 (879 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-ace... 28 1.5 SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 27 3.5 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.1 SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula... 26 8.1 >SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase Alg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 162 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 144 YVARSESIMRDSDVAFSHSAALAIAQVRRNGNR 46 Y ES + D+ + SH+ A +I Q R+G R Sbjct: 63 YAPEIESYIHDASIVISHAGAGSILQTLRSGKR 95 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 27.1 bits (57), Expect = 3.5 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = -1 Query: 861 PXLQHXPLPEXSAPLPXXXXLXPEPPPXXPXHXXQXTLXXKXLP--PXXXPP 712 P H PL P+ L P P P P H +L LP P PP Sbjct: 134 PHSHHPPL-HNPLPVSCQPVLRPPPVPQVPSHWYPVSLPSPNLPHQPISKPP 184 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 864 QPXLQHXPLPEXSAPLPXXXXLXPEPPPXXP 772 +P L + P+PE PLP L EP P P Sbjct: 106 EPPLPNEPVPEE--PLPGEPPLPDEPVPEEP 134 >SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1400 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 26 MSTTYIILLPFLLTCAIASAAECENATSLS 115 +S TYIILLPF C A +++ +S Sbjct: 1023 LSKTYIILLPFQSLCPGGKQANHQSSEKMS 1052 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,831,522 Number of Sequences: 5004 Number of extensions: 26225 Number of successful extensions: 65 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -