BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A13 (879 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 27 0.30 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 25 0.92 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 26.6 bits (56), Expect = 0.30 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 328 PREXLWRPDLXVAXSRMXAXAGTTPLXARXXNNGS 432 P LW+PD+ + S GT P NNG+ Sbjct: 101 PPHRLWKPDVLMYNSADEGFDGTYPTNVVVKNNGT 135 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 25.0 bits (52), Expect = 0.92 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 38 YIILLPFLLTCAIAS-AAECENATSLSLMIDSLLAT 142 Y ILL L+TC I S + C T S + D ++AT Sbjct: 3 YSILLSLLITCLICSPSVHC--GTRPSFVSDEMIAT 36 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,917 Number of Sequences: 438 Number of extensions: 2181 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -