BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A10 (858 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U46673-4|AAC48152.2| 1535|Caenorhabditis elegans Laminin related... 28 7.4 AF078788-1|AAC26965.2| 629|Caenorhabditis elegans Hypothetical ... 28 7.4 >U46673-4|AAC48152.2| 1535|Caenorhabditis elegans Laminin related. see also lmb-protein 2 protein. Length = 1535 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 13 GQLRTGTDKGNPD-CLIKTKHCDGPRGC*RNVISAQCSEC 129 G GT + N D L++ DG C NVI QC +C Sbjct: 876 GCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQC 915 >AF078788-1|AAC26965.2| 629|Caenorhabditis elegans Hypothetical protein ZC190.4 protein. Length = 629 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/45 (28%), Positives = 28/45 (62%) Frame = -1 Query: 507 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCY 373 +GT+ + DIID +P N +S++ + +++ R ET++H+ + Sbjct: 287 VGTR-KTSTDIIDGFNVPSNMISDDNLPALIY--RVIETLNHMIF 328 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,783,677 Number of Sequences: 27780 Number of extensions: 396685 Number of successful extensions: 998 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2139963672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -