BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A08 (857 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 25 0.68 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.68 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 3.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 3.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 3.6 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 25.4 bits (53), Expect = 0.68 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 464 NCGGPGNSSAGSAV 505 N GGPG+SSAG V Sbjct: 18 NLGGPGSSSAGGVV 31 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 238 LRMLDVQIRKAVGQWLRLPADVPKAYYHAAVQ 333 L ++ V + + G+WL +PK +A+V+ Sbjct: 62 LSLVVVTVAISTGEWLLTEEKLPKTSSNASVE 93 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.4 bits (53), Expect = 0.68 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 604 VGTQRRRSSRPVKQQGLGFVERHLRSQPSDPCDDG*TCGAVSRPTAV-SYESYQIW 440 VG RP + LG++ R P P + TC + R T + S S+ W Sbjct: 1627 VGGATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVIRSIRSHSTW 1682 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 237 IENARCPNPESSRTVAK 287 I N RC NP++ RT K Sbjct: 411 ILNTRCENPDNDRTPFK 427 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 237 IENARCPNPESSRTVAK 287 I N RC NP++ RT K Sbjct: 411 ILNTRCENPDNDRTPFK 427 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 237 IENARCPNPESSRTVAK 287 I N RC NP++ RT K Sbjct: 411 ILNTRCENPDNDRTPFK 427 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 246,323 Number of Sequences: 438 Number of extensions: 5465 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27673956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -