BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A04 (847 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 74 8e-13 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 73.7 bits (173), Expect = 8e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 500 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSC*K 390 MIGRADIEGSKS+VAMNAW PQASYPCGNFS TSC K Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLK 37 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,210,079 Number of Sequences: 237096 Number of extensions: 2666301 Number of successful extensions: 4831 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4828 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10705443456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -