BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A01 (1053 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 32 0.66 08_02_1615 + 28257275-28258428,28258523-28259144 26 1.9 08_01_0112 - 885965-886010,887084-887145,887908-887976,888076-88... 31 2.0 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 26 3.2 08_02_0796 - 21300251-21300373,21300846-21301721 30 3.5 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 30 3.5 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 30 3.5 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 30 3.5 07_03_0154 + 14509979-14512033 29 4.7 04_04_1687 - 35365766-35366356,35367137-35368135 29 4.7 12_01_0841 - 7873458-7874225 25 5.8 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 26 6.6 12_02_1174 - 26696869-26698191 29 8.2 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 8.2 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 8.2 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 8.2 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 8.2 07_01_0080 + 587674-588510 29 8.2 06_03_0729 + 23927656-23927661,23927774-23927923,23928316-239285... 29 8.2 05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287... 29 8.2 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 8.2 02_05_0686 - 30900748-30902167,30903442-30904742 29 8.2 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 29 8.2 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 32.3 bits (70), Expect = 0.66 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 64 FLXPVXXXPXXPPPXXPPPPP 2 FL P P PPP PPPPP Sbjct: 35 FLCPPPPPPPPPPPPPPPPPP 55 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPP 56 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 31 PPPXXPPPPP 2 PPP PPPPP Sbjct: 68 PPPKSPPPPP 77 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPP 5 P P P P PPPP Sbjct: 54 PAAAAPPPPAPLTPPPP 70 >08_01_0112 - 885965-886010,887084-887145,887908-887976,888076-888123, 888205-888264,888392-888504,888578-888650,888725-888769, 889382-889527,890782-890842,891913-892056,892164-892400 Length = 367 Score = 30.7 bits (66), Expect = 2.0 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +3 Query: 6 GGGGXXGGGXLGXNXTGXRXSFVRTXLAXRGVAQVDQLSVKVSD 137 GGGG GGG G G R RT +A R +V + +V VSD Sbjct: 82 GGGGGGGGGFGGQGHAGKRRMNSRTSMAQRD--EVIRRTVYVSD 123 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 25.8 bits (54), Expect(2) = 3.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 31 PPPXXPPPPP 2 PPP PPPPP Sbjct: 77 PPPPPPPPPP 86 Score = 22.6 bits (46), Expect(2) = 3.2 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPP 5 P P PPP PP P Sbjct: 51 PADTTPTSPPPASPPLP 67 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P+ P PPP PPPPP Sbjct: 98 PLLALPPPPPPPPPPPPP 115 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 61 LXPVXXXPXXPPPXXPPPPP 2 L P P PPP PPPPP Sbjct: 424 LPPPPPLPPPPPPPPPPPPP 443 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 61 LXPVXXXPXXPPPXXPPPPP 2 L P P PPP PPPPP Sbjct: 17 LGPPAPAPVPPPPPPPPPPP 36 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 61 LXPVXXXPXXPPPXXPPPPP 2 L P P PPP PPPPP Sbjct: 351 LMPPPPPPPPPPPPPPPPPP 370 Score = 29.1 bits (62), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 61 LXPVXXXPXXPPPXXPPPPP 2 + P P PPP PPPPP Sbjct: 352 MPPPPPPPPPPPPPPPPPPP 371 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 349 PKLMPPPPPPPPPPPPPP 366 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 360 PPPPPPPPPPPPRPPPPP 377 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 361 PPPPPPPPPPPRPPPPPP 378 >07_03_0154 + 14509979-14512033 Length = 684 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 49 PAAAPPPPPPPPPPPPPP 66 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 5 PAATAPPPPPPPPPPPPP 22 >12_01_0841 - 7873458-7874225 Length = 255 Score = 25.0 bits (52), Expect(2) = 5.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 6 GGGGXXGGGXLGXNXTG 56 GGGG GGG G N +G Sbjct: 146 GGGGGGGGGQGGGNGSG 162 Score = 25.0 bits (52), Expect(2) = 5.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 6 GGGGXXGGGXLGXNXTG 56 GGGG GGG G N +G Sbjct: 185 GGGGGGGGGQGGGNGSG 201 Score = 22.6 bits (46), Expect(2) = 5.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 3 GGGGGXXGGG 32 GGGGG GGG Sbjct: 110 GGGGGGQGGG 119 Score = 22.6 bits (46), Expect(2) = 5.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 3 GGGGGXXGGG 32 GGGGG GGG Sbjct: 149 GGGGGGQGGG 158 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 25.8 bits (54), Expect(2) = 6.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 31 PPPXXPPPPP 2 PPP PPPPP Sbjct: 91 PPPSPPPPPP 100 Score = 21.4 bits (43), Expect(2) = 6.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 Query: 40 PXXPPPXXPPPP 5 P PP PPPP Sbjct: 42 PMPGPPSQPPPP 53 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 148 PPPSLPPPPPPPPPPPPP 165 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 21 PELRLPPPPPPHPPPPPP 38 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 74 PPPQTPPSPPPPPPPPPP 91 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 75 PPQTPPSPPPPPPPPPPP 92 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 259 PQSVRPPPPPPPPPPPPP 276 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 108 PPPPPPPSPPPSAPPPPP 125 >07_01_0080 + 587674-588510 Length = 278 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 99 PSSGSPPPPPPPPPPPPP 116 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 104 PPPPPPPPPPPPPPPPPP 121 >06_03_0729 + 23927656-23927661,23927774-23927923,23928316-23928567, 23929072-23929209,23931213-23932730 Length = 687 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 203 PSSDAPSPPPPSPPPPPP 220 >05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613, 2879715-2879973,2880060-2880346,2880423-2880758, 2880862-2881003,2881077-2881297,2881379-2881540, 2881617-2881775,2881860-2882159,2882834-2883097, 2883133-2883243,2883902-2883988 Length = 1871 Score = 28.7 bits (61), Expect = 8.2 Identities = 21/80 (26%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = -3 Query: 529 PGPGEX-STPPVVAAAXSXTTSGLXQAFXRTPAQVLQ--PHSPAFQTQSXVDPIHLKXCP 359 PGPG S+ P + + + +P+ V PHSP S PI+ P Sbjct: 1601 PGPGSFTSSSPYNPVSPFYSPASPLSCPLTSPSYVPTSLPHSPTSPIYSATSPIYSPSSP 1660 Query: 358 VSAPVDLGLXNVSMSHXPGS 299 + +P L S + P S Sbjct: 1661 IYSPTSLSYSPTSPVYSPTS 1680 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 345 PSNAPPPPPPPPPPPPPP 362 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 331 PPKAAPPPPPPKGPPPPP 348 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 99 PPPSLPPPPPPLRPPPPP 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,984,856 Number of Sequences: 37544 Number of extensions: 515088 Number of successful extensions: 9171 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5675 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3117811332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -