BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_A01 (1053 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 3.6 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 3.6 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.6 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 4.7 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 29 6.3 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 8.3 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_9194| Best HMM Match : SWIM (HMM E-Value=0.01) 29 8.3 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 29 8.3 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.9 bits (64), Expect = 3.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P+ P PPP PPPPP Sbjct: 75 PLCAPPPPPPPPPPPPPP 92 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 74 PPLCAPPPPPPPPPPPPP 91 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.9 bits (64), Expect = 3.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P+ P PPP PPPPP Sbjct: 276 PLCAPPPPPPPPPPPPPP 293 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 275 PPLCAPPPPPPPPPPPPP 292 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.9 bits (64), Expect = 3.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P+ P PPP PPPPP Sbjct: 911 PLPLAPEPPPPLPPPPPP 928 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 97 PACCAPPPPPPPPPPPPP 114 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 70 KXFLXPVXXXPXXPPPXXPPPPP 2 K + P P PPP PPPPP Sbjct: 1302 KEQIQPPESPPPPPPPPPPPPPP 1324 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 1308 PESPPPPPPPPPPPPPPP 1325 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 61 LXPVXXXPXXPPPXXPPPPP 2 + P P PPP PPPPP Sbjct: 681 MVPPPPPPPPPPPPPPPPPP 700 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 684 PPPPPPPPPPPPPPPPPP 701 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 61 LXPVXXXPXXPPPXXPPPPP 2 + P P PPP PPPPP Sbjct: 363 MSPPPPPPPPPPPPSPPPPP 382 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPP 383 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPP 387 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 376 PSPPPPPPPPPPSPPPPP 393 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPP 399 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 387 PSPPPPPQPPPPPPPPPP 404 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 390 PPPPQPPPPPPPPPPPPP 407 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPP 408 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 392 PPQPPPPPPPPPPPPPPP 409 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 393 PQPPPPPPPPPPPPPPPP 410 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPP 412 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPP 413 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPP 414 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPP 415 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPP 416 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPP 417 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPP 418 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 407 PPPPPPPPPPPPAPPPPP 424 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 408 PPPPPPPPPPPAPPPPPP 425 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 412 PPPPPPPAPPPPPPPPPP 429 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 413 PPPPPPAPPPPPPPPPPP 430 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 415 PPPPAPPPPPPPPPPPPP 432 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPP 884 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 868 PPPPPPPPPPPPPPPPPP 885 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPP 481 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPP 482 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPP 483 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPP 484 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPP 485 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPP 486 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPP 487 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 476 PPPPPPPPPPPPFPPPPP 493 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 477 PPPPPPPPPPPFPPPPPP 494 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 1166 PPPSSPSPPPPPPPPPPP 1183 >SB_9194| Best HMM Match : SWIM (HMM E-Value=0.01) Length = 701 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 192 AAECENATSLSRHDRLAPRQXTIGSLPPHCKIVGQPDP 305 +A+C+N ++ + PRQ T+ S C++V P P Sbjct: 514 SADCKNTERVTLYRARVPRQKTLISEKRKCRLVLMPSP 551 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 190 PPSGGPPPPPPPPPPPPP 207 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 55 PVXXXPXXPPPXXPPPPP 2 P P PPP PPPPP Sbjct: 191 PSGGPPPPPPPPPPPPPP 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,483,260 Number of Sequences: 59808 Number of extensions: 428128 Number of successful extensions: 2885 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1836 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3165923931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -