BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_H11_e472_15.seq (1495 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 32 0.037 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 25 7.4 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 32.3 bits (70), Expect = 0.037 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = +3 Query: 660 IAAKMMQIMGWSGG-GLGVDEQGISEPIKPNLQ 755 I AK++ MG+ G GLG D QGIS PI+ +L+ Sbjct: 171 IGAKLLLQMGYQPGKGLGKDLQGISAPIEAHLR 203 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.6 bits (51), Expect = 7.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 837 SAASVSMRLDAXGACPSRYCQDRHVLP 757 SA +VS RL A G C R + R +LP Sbjct: 18 SAKTVSRRLHAAGFCARRPRKVRKLLP 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,113,989 Number of Sequences: 2352 Number of extensions: 22077 Number of successful extensions: 54 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 174749850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -