BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_H09_e456_15.seq (1527 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 31 0.088 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 29 0.35 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 31.1 bits (67), Expect = 0.088 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 257 EDLWLVEFYAPWCGHCKNLEPHWAKAATELKGKVKV 364 + L +V+F+A WCG CK + P + + K+ V Sbjct: 20 DQLVVVDFFATWCGPCKVIAPKLEEFQNKYADKIVV 55 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 29.1 bits (62), Expect = 0.35 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -2 Query: 452 SWETSSXVXXTLHL--VTXGHGLMHSRICGNRLLPCP 348 SW++ T HL V GHG +CG +L P Sbjct: 978 SWQSRKHGDVTFHLSQVLSGHGFFREHLCGMQLTSSP 1014 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,559 Number of Sequences: 2352 Number of extensions: 10342 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 179220195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -