BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_H08_e448_16.seq (1503 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1136 + 24218601-24218734,24218769-24219906 38 0.021 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 35 0.15 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 35 0.15 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 34 0.34 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 33 0.44 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.44 11_06_0610 - 25449085-25453284 33 0.59 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 33 0.59 03_05_0067 - 20460206-20460703,20461255-20461530 33 0.59 01_06_0565 + 30287253-30287502,30287522-30289010,30289133-302892... 33 0.77 09_02_0495 + 9880714-9881196 32 1.0 07_01_0080 + 587674-588510 32 1.0 03_05_0928 + 28888405-28889121 32 1.0 01_01_0715 - 5542648-5543219,5543352-5543544 32 1.0 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 32 1.4 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 32 1.4 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 31 1.8 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 1.8 05_01_0142 - 940421-940701,941262-941574 31 1.8 04_04_1695 + 35433975-35437040 31 1.8 04_04_0201 - 23555336-23556008,23556097-23556258,23556353-235572... 31 1.8 03_01_0515 - 3864796-3865425 31 1.8 06_02_0046 + 10928708-10928798,10929997-10930077,10930567-109306... 31 2.4 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 31 3.1 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 31 3.1 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 3.1 08_01_0059 - 394001-394708 30 4.1 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 30 4.1 04_04_0126 + 22952577-22952871,22952912-22953519,22954125-229545... 30 4.1 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 30 4.1 03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539,525... 30 4.1 02_04_0400 - 22608519-22608844,22609044-22609122 30 4.1 01_05_0319 - 20871781-20871909,20872001-20872053,20873271-20873598 30 4.1 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 26 4.9 09_04_0005 + 13612060-13612291,13612381-13612510,13612726-136129... 30 5.5 08_02_1334 - 26224546-26225337 30 5.5 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 30 5.5 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 30 5.5 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 30 5.5 02_01_0302 - 2021221-2023305 30 5.5 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 30 5.5 12_02_1114 - 26171876-26172493 29 7.2 10_07_0161 - 13674631-13675433,13675793-13675862 29 7.2 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 7.2 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 7.2 07_03_0560 + 19479597-19480667 29 7.2 06_02_0175 - 12624608-12625297 29 7.2 03_01_0023 + 198414-198968 29 7.2 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 7.2 01_01_0082 + 625198-625719 25 9.1 09_04_0424 + 17444261-17444665,17445974-17446367,17447367-174474... 29 9.5 06_03_1326 - 29355467-29355817 29 9.5 06_01_0102 + 834660-834911,835460-835568,835891-836006,836116-83... 29 9.5 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 29 9.5 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 29 9.5 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 29 9.5 03_05_0252 - 22403504-22404676 29 9.5 01_03_0008 + 11594061-11594078,11594201-11594285,11594506-11595149 29 9.5 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 37.9 bits (84), Expect = 0.021 Identities = 29/89 (32%), Positives = 32/89 (35%), Gaps = 4/89 (4%) Frame = -3 Query: 1285 GGGXXXGGXGXPPG---GXGAXXXSPXXGGGGXAXXXXXXXXXXXXKXXGGXXPPPPPXX 1115 GGG G PPG G GA +P GGGG A GG PP Sbjct: 110 GGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGG-----GGALARPPGGG 164 Query: 1114 KXXXXXPPPXXXXXXGXK-KNPXGXGGGG 1031 + PP G + P G GGGG Sbjct: 165 RGGALGRPPGGGGGGGGPGRAPGGGGGGG 193 Score = 33.9 bits (74), Expect = 0.34 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -1 Query: 1221 PPXXGGGGXXPPLXXXXXXXXXXGWGGXRPPXPPXXKXXXXXPPPXXGLXLGXKKTPXAX 1042 PP GGGG PL G GG P PP PP G G Sbjct: 91 PP--GGGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVL 148 Query: 1041 GGGG 1030 GGGG Sbjct: 149 GGGG 152 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 1263 GXXXPPGXXGRXXXPPXXGGGGXXPPLXXXXXXXXXXGWGGXRPPXP 1123 G PG G P GGGG PP G GG RPP P Sbjct: 93 GGGGAPGPLGGGGARPPGGGGGGGPP----SLPPGAGGGGGARPPAP 135 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGGXAXXXXXXXXXXXXKXXGGXXPPPPPXXKXX 1106 GGG GG G G S GGGG GG PP P Sbjct: 296 GGGGGGGGGGGGGHGAPELGFSGGGGGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGGG 355 Query: 1105 XXXPPPXXXXXXGXKKNPXGXGGGG 1031 K G GGGG Sbjct: 356 GGGGGGTKVRVCAPKDISGGGGGGG 380 Score = 31.5 bits (68), Expect = 1.8 Identities = 30/114 (26%), Positives = 31/114 (27%) Frame = +2 Query: 995 GGXXPKGXXKKXPPPPXAXGVFFXPXXXPXXGGGXXXXXFXXGGXGGRXPPXPLXXXXXX 1174 GG P PP G P P GGG GG GG P + Sbjct: 94 GGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGG 153 Query: 1175 XXXRGGXXPPPPXXGGXXXRPXXPGGXXXPXXXRXPPPXXGXXXXXXXXAXGGG 1336 PP GG RP PGG P G GGG Sbjct: 154 GGAL--ARPPGGGRGGALGRP--PGGGGGGGGPGRAPGGGGGGGGPGRAPGGGG 203 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXX---SPXXGGGG 1199 GGG GG G PGG G +P GGGG Sbjct: 174 GGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGG 205 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGGXA 1193 GGG GG G PGG G GG G A Sbjct: 187 GGGGGGGGPGRAPGGGGGGGGLGGGGGEGGA 217 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPP 1499 PPP G PPPPP GPP Sbjct: 5 PPPPGTGAPPPPPPAAVGPP 24 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPPXXXG 1298 PPPP AP PPG P PP PPP G Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPP---PPPGAAG 378 Score = 24.2 bits (50), Expect(2) = 7.7 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 1452 GXXXPPPPPXXXTGPPP 1502 G PPPPP P P Sbjct: 317 GTGAPPPPPAHPAAPAP 333 Score = 23.4 bits (48), Expect(2) = 7.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 1440 PPPXGXXXPPPPP 1478 PPP G P PPP Sbjct: 277 PPPAGPPPPAPPP 289 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP P PP P PP PPP Sbjct: 95 PPPPYGVNSSQPPPPPPPPPSPPPSAPPP 123 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP G P PPP GPPP Sbjct: 12 PPPQGGFPPQPPPMNPYGPPP 32 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP P PP G P PP PPP Sbjct: 30 PPPPQQPAYGHMP-PPQGAP-PPFLAPPP 56 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 33.5 bits (73), Expect = 0.44 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP TGP P Sbjct: 591 PPPAPKAAPPPPPPKSTGPGP 611 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 A PPPP + P PP G P PP PP Sbjct: 324 AAPPPPPPPKAAPPPPPPKGPPPPPPAKGPP 354 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 1419 PXRXXXXPPPXGXXXPPPPPXXXTGPPP 1502 P PPP PPPPP PPP Sbjct: 321 PAAAAPPPPPPPKAAPPPPPPKGPPPPP 348 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 346 PPPPAKGPPPPPPPKGPSPPP 366 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPP 1283 PPPP G P PPGG P PP Sbjct: 355 PPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 1440 PPPXGXXXPPPPP--XXXTGPPP 1502 PPP G PPPPP GPPP Sbjct: 357 PPPKGPSPPPPPPPGGKKGGPPP 379 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP + PPP Sbjct: 347 PPPAKGPPPPPPPKGPSPPPP 367 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 329 PPPPKAAPPPPPPKGPPPPPP 349 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 337 PPPPPKGPPPPPPAKGPPPPP 357 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPP----GGXPXPPXXXPPP 1286 A PPPP AP PP P PP PPP Sbjct: 312 APPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPP 346 Score = 29.1 bits (62), Expect = 9.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PP PPPPP PPP Sbjct: 318 PPKPAAAAPPPPPPPKAAPPP 338 Score = 29.1 bits (62), Expect = 9.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 P P PPPPP PPP Sbjct: 319 PKPAAAAPPPPPPPKAAPPPP 339 Score = 29.1 bits (62), Expect = 9.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPP 356 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 33.1 bits (72), Expect = 0.59 Identities = 25/98 (25%), Positives = 27/98 (27%), Gaps = 3/98 (3%) Frame = +3 Query: 999 GXXPKXPXKNXPPPPXPXGFFFXPXXXXXXGGGXXXXFXXKGGGGGXXPPXXXXXXXXXX 1178 G P P + PPP P G P G K PP Sbjct: 553 GKSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASP----PPTPEEYTPSPP 608 Query: 1179 XXXXXAXPPPPXXGEXXXAPXPP---GGXPXPPXXXPP 1283 A PP +P PP G P PP PP Sbjct: 609 KSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPP 646 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/96 (21%), Positives = 22/96 (22%), Gaps = 1/96 (1%) Frame = +3 Query: 999 GXXPKXPXKNXPPPPXPXGFFFXPXXXXXXGGGXXXXFXXKGGGGGXXPPXXXXXXXXXX 1178 G P P PPP P + P K P Sbjct: 584 GESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPES 643 Query: 1179 XXXXXAXPPPPXX-GEXXXAPXPPGGXPXPPXXXPP 1283 PP P P P G P PP PP Sbjct: 644 TPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPP 679 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 1128 GGGXXPPXXXXXXXXXXXXXXXAXPPPPXXGEXXXAPXPPGGXPXPPXXXPP 1283 G G PP A PPP G AP PGG P PP P Sbjct: 643 GAGPVPPPIAVAPPPAPPIAGAAPPPPMANGAAAAAP--PGGNPAPPAGPQP 692 Score = 29.5 bits (63), Expect = 7.2 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PP PP PPP Sbjct: 648 PPPIAVAPPPAPPIAGAAPPP 668 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 33.1 bits (72), Expect = 0.59 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPPXXXG 1298 PPPP + P G P PP PPP G Sbjct: 27 PPPPQYFQGAHPPAAMWGQPPPPQAAPPPAPAG 59 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 1440 PPPXGXXXPPPPP-XXXTGPPP 1502 PPP PPPPP GPPP Sbjct: 6 PPPQWAMGPPPPPQYFQAGPPP 27 >01_06_0565 + 30287253-30287502,30287522-30289010,30289133-30289277, 30289679-30289729 Length = 644 Score = 32.7 bits (71), Expect = 0.77 Identities = 29/123 (23%), Positives = 30/123 (24%), Gaps = 6/123 (4%) Frame = +2 Query: 1121 GGXGGRXPPXP-LXXXXXXXXXRGGXXPPP---PXXGGXXXRPXXPGGXXXPXXXRXPPP 1288 GG GG PP P + GG P P P P PGG P Sbjct: 98 GGGGGYNPPSPSIGTSPTTPGGGGGYTPTPSDTPPSPSSDTSPSTPGGGCSSSPTPCDAP 157 Query: 1289 XXGXXXXXXXXAXGGGXXFXXXXXXXXPPXXHIKKR--GGGXXXXPXPXXXXXPPXGXXX 1462 GGG P GGG P P PP Sbjct: 158 PSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTPTP--SDAPPSPSSD 215 Query: 1463 XPP 1471 P Sbjct: 216 TSP 218 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 1221 PPXXGGGGXXPPLXXXXXXXXXXGWGGXRPPXP 1123 PP GGGG PP G GG P P Sbjct: 95 PPQGGGGGYNPPSPSIGTSPTTPGGGGGYTPTP 127 Score = 29.5 bits (63), Expect = 7.2 Identities = 29/122 (23%), Positives = 31/122 (25%), Gaps = 5/122 (4%) Frame = -1 Query: 1332 PPXAXXXXXXXLPXXGGGXRXXXGXXXPPGXXGRXXXPPXXGGG-----GXXPPLXXXXX 1168 PP P GGG P P GGG PP Sbjct: 157 PPSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDT 216 Query: 1167 XXXXXGWGGXRPPXPPXXKXXXXXPPPXXGLXLGXKKTPXAXGGGGXFFXXPLGXXPPXX 988 G GG P P PP +P GGGG + P PP Sbjct: 217 SPTTPGGGGGYTPTP------SDAPP-----SPSSDTSPTTPGGGGGYTPTP-SDTPPSP 264 Query: 987 XS 982 S Sbjct: 265 SS 266 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 1130 GGRXPPXP-LXXXXXXXXXRGGXXPPPPXXGGXXXRPXXP 1246 GG PP P + GG PP P GG P P Sbjct: 507 GGYYPPTPSIGTSPSTPGTGGGYYPPSPSTGGYTPTPDVP 546 Score = 29.1 bits (62), Expect = 9.5 Identities = 21/100 (21%), Positives = 22/100 (22%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPPXXXGXXXXXXXXXXXXXXXXXXXXXXXXPXX 1379 PP P G P G P P PP G Sbjct: 389 PPSPASGTSPSTPGSGGYSPSTPCSAPPSPSSGTSPTTPGGGYSPSTPCNAPPSPSSDTS 448 Query: 1380 XT*KKGGGGXXXXPXRXXXXPPPXGXXXPPPPPXXXTGPP 1499 T GGG P P P P P + P Sbjct: 449 PT-TPGGGNYPPAPTIGNVPPSPSSGTSPSTPGGGCSSSP 487 >09_02_0495 + 9880714-9881196 Length = 160 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = -3 Query: 1132 PPPPXXKXXXXXPPPXXXXXXGXKKNPXGXGGGGXFFXGXFGXXPP 995 PPP PPP + G GG G F G + PP Sbjct: 39 PPPIAGGAVNSYPPPPPAGSSSSSSSGGGDGGAGGLFGGTYPPPPP 84 >07_01_0080 + 587674-588510 Length = 278 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 1395 GGGGXXXXPXRXXXXPPPXGXXXPPPPPXXXTGPPP 1502 GG G P PP G PPPPP PPP Sbjct: 83 GGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP +P PP P PP PPP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP P PP P PP PPP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 >03_05_0928 + 28888405-28889121 Length = 238 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G P G GA S GGG Sbjct: 183 GGGGGGGGSGGPGAGGGAQTSSSTTRGGG 211 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 1200 PPPPXXGE--XXXAPXPPGGXPXPPXXXPPP 1286 PPPP G AP PP P P PPP Sbjct: 161 PPPPAAGTNGTARAPSPPVPAPAPAGSPPPP 191 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 1194 AXPPPPX-XGEXXXAPXPPGG-XPXPPXXXPPP 1286 A PPPP G+ AP PP P PP PPP Sbjct: 749 APPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPP 781 Score = 29.5 bits (63), Expect = 7.2 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 1190 GXXPPPPXXGGXXXRPXXPGGXXXPXXXRXPPPXXGXXXXXXXXAXGGG 1336 G PPPP G RP P PPP G A G G Sbjct: 776 GTVPPPPPLHGASGRPHPPSSKG--LNAPAPPPLLGRGREATGSAKGRG 822 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP + P PP P PP PP Sbjct: 418 PPPPLPSDAFEQPPPPPEHPPPPESTSPP 446 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 P P G PPPPP GPPP Sbjct: 618 PRPPGAPPPPPPPGKPGGPPP 638 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPPGGXPXPPXXXPP 1283 A PPPP P PP G P P PP Sbjct: 612 ALPPPPPRPPGAPPPPPPPGKPGGPPPPPP 641 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 P P G PPPPP GPPP Sbjct: 923 PRPPGAPPPPPPPGKPGGPPP 943 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP P PPG PP PPP Sbjct: 920 PPPPRPPGAPPPPPPPGKPGGPPPPPPPP 948 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP P PPG P PP PPP Sbjct: 41 PPPPGA-----YPPPPGAYPPPPGAYPPP 64 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPPGGXPXPPXXXPP 1283 A PPPP P PPG P PP PP Sbjct: 46 AYPPPPGA-----YPPPPGAYPPPPGAYPP 70 >04_04_1695 + 35433975-35437040 Length = 1021 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPPGGXPXPP 1268 A PPPP G+ P PPG P PP Sbjct: 226 AAPPPPP-GQTVIMPRPPGPAPGPP 249 >04_04_0201 - 23555336-23556008,23556097-23556258,23556353-23557206, 23557452-23557613,23558197-23558649,23559729-23559788, 23559983-23560058,23561546-23561593,23561948-23562022, 23562067-23562494 Length = 996 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = -1 Query: 1263 GXXXPPGXXGRXXXPPXXGGGGXXPPLXXXXXXXXXXGWGGXRPPXPPXXKXXXXXPPP 1087 G P G G P G GG P + G G P PP PPP Sbjct: 822 GSASPGGGAGSSSQPHGVGVGGRRPEVPSVQESLMRLGGGCGAAPFPPHFGLHLPPPPP 880 >03_01_0515 - 3864796-3865425 Length = 209 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 1419 PXRXXXXPPPXGXXXPPPPPXXXTGPPP 1502 P PPP PPPPP PPP Sbjct: 76 PPSVTSSPPPPPLPPPPPPPAASPPPPP 103 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPP---GGXPXPPXXXPPP 1286 + PPPP G P PP P PP PPP Sbjct: 59 SSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPP 92 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 75 PPPSVTSSPPPPPLPPPPPPP 95 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPP-GGXPXPPXXXPPP 1286 PPPP P PP P PP PPP Sbjct: 72 PPPPPPSVTSSPPPPPLPPPPPPPAASPPP 101 >06_02_0046 + 10928708-10928798,10929997-10930077,10930567-10930685, 10931275-10931894,10931992-10933184,10933280-10933359, 10933751-10933846,10933931-10934004,10936007-10936151, 10936323-10936487 Length = 887 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 496 PPPEDEWIPPPPPENEPAPPP 516 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 30.7 bits (66), Expect = 3.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 + PPPP P PP P P PPP Sbjct: 36 SAPPPPARHRAPSPPRPPPPPPPPTQPAPPP 66 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 30.7 bits (66), Expect = 3.1 Identities = 30/102 (29%), Positives = 32/102 (31%), Gaps = 7/102 (6%) Frame = +2 Query: 1013 GXXKKXPPPPXAXGVFFXPXXXPXXG-GGXXXXXFXXGGXGGRXPPXPLXXXXXXXXXRG 1189 G + P PP G+ P P G GG G GG PP G Sbjct: 1131 GGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPP----------NAHG 1180 Query: 1190 GXXPPPP------XXGGXXXRPXXPGGXXXPXXXRXPPPXXG 1297 G PPPP GG P P P PPP G Sbjct: 1181 GVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPG 1222 Score = 30.3 bits (65), Expect = 4.1 Identities = 31/94 (32%), Positives = 33/94 (35%), Gaps = 5/94 (5%) Frame = +2 Query: 1031 PPPPXAXGVFFXPXXXPXXG-GGXXX--XXFXXGGXGGRXPPXPLXXXXXXXXXRGGXXP 1201 PPPP G+ P P G GG G GG PP P+ GG Sbjct: 1110 PPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGL-------GGPPA 1162 Query: 1202 PPPXXG--GXXXRPXXPGGXXXPXXXRXPPPXXG 1297 PPP G G P GG P PPP G Sbjct: 1163 PPPPAGFRGGTPPPNAHGGVAPP-----PPPPRG 1191 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 1440 PPPX---GXXXPPPPPXXXTGPPP 1502 PPP G PPPPP TG PP Sbjct: 1100 PPPSIGAGAPPPPPPPGGITGVPP 1123 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPG-GXPXPPXXXPPPXXXG 1298 P PP G+ AP PP G PP PP G Sbjct: 1087 PLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITG 1120 Score = 29.1 bits (62), Expect = 9.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 P P G PP PP GPPP Sbjct: 1199 PTPPGAPAPPMPPGVPGGPPP 1219 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP G PPPPP PP Sbjct: 297 PPPVGGTQPPPPPPPLANGPP 317 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 1203 PPPXXGEXXXAPXPPGGXPXPPXXXPPPXXXG 1298 PPP G P PP PP PPP G Sbjct: 296 PPPPVGGTQPPPPPPPLANGPPRSIPPPPMTG 327 Score = 29.5 bits (63), Expect = 7.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP G PP Sbjct: 273 PPPPPQAPPPPPPNAPMGMPP 293 >08_01_0059 - 394001-394708 Length = 235 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP AP PP P PP PPP Sbjct: 2 PPPP---PPRRAPPPPATPPPPPRRAPPP 27 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 47 PPPPQPTLPPPPPRTLPPPPP 67 >04_04_0126 + 22952577-22952871,22952912-22953519,22954125-22954596, 22954882-22954955,22955559-22955937,22956659-22956711 Length = 626 Score = 30.3 bits (65), Expect = 4.1 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Frame = +2 Query: 320 PHDIGTNCVYTQIAINXXXXXXTDFK*NSLFHTSACPSDVTMVNIIYR----HWLSESFP 487 P G + + N ++K +S+F +C S V +++I Y WLS Sbjct: 61 PEADGDGATFVRTCFNGLNALSGEYKKHSIFGRRSCSSGVGLLSIPYALSEGGWLSLVLL 120 Query: 488 RSIFFPLCYRLLLIR 532 ++ CY LL+R Sbjct: 121 LAVAMVCCYTGLLLR 135 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 1395 GGGGXXXXPXRXXXXPPPXGXXX--PPPPPXXXTGPPP 1502 GGGG R P G PPPPP PPP Sbjct: 119 GGGGGFDALYRAPIGPYVRGATAPPPPPPPPMAVAPPP 156 >03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539, 5252836-5253019,5253564-5253814,5253921-5254024, 5254143-5254281 Length = 363 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1398 GGGXXXXPXRXXXXPPPXGXXXPPPPPXXXTGPPP 1502 GGG P R PPPPP T PPP Sbjct: 15 GGGHRLLPSRPSTS---AASQPPPPPPSAATPPPP 46 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 30.3 bits (65), Expect = 4.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGGXAXXXXXXXXXXXXKXXGGXXPPP 1127 GGG GG G GG G GGGG GG PP Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPP 96 >01_05_0319 - 20871781-20871909,20872001-20872053,20873271-20873598 Length = 169 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 1187 GGXXPPPPXXGGXXXRPXXPGG 1252 GG PPPP G R PGG Sbjct: 11 GGGTPPPPTGAGSGSRAGAPGG 32 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 25.8 bits (54), Expect(2) = 4.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 1467 PPPPXXXTGPPP 1502 PPPP T PPP Sbjct: 72 PPPPSTTTAPPP 83 Score = 22.6 bits (46), Expect(2) = 4.9 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 1425 RXXXXPPPXGXXXPPPP 1475 R PPP PPPP Sbjct: 29 RSVLPPPPAPHHAPPPP 45 >09_04_0005 + 13612060-13612291,13612381-13612510,13612726-13612926, 13613086-13613185,13613513-13613559,13613871-13613964, 13614042-13614192,13614777-13614923,13614994-13615067, 13615288-13615376,13615840-13615954,13616104-13616301 Length = 525 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -3 Query: 1132 PPPPXXKXXXXXPPPXXXXXXGXKKNPXGXGGGG 1031 PPPP PPP G GGGG Sbjct: 56 PPPPSSPASASAPPPLPESAAAGLDAGIGGGGGG 89 >08_02_1334 - 26224546-26225337 Length = 263 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 1395 GGGGXXXXPX--RXXXXPPPXGXXXPPPPPXXXTGP 1496 GGGG P R P P PPPPP T P Sbjct: 99 GGGGEGGDPLVRRAVSLPAPVTATPPPPPPPPETPP 134 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 1200 PPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 PPPP AP P P PP PPP Sbjct: 234 PPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = -3 Query: 1135 PPPPPXXKXXXXXPPPXXXXXXGXKKNPXGXGGGG 1031 PPPP K PPP P G GG Sbjct: 63 PPPPQYAKHFAAGPPPAAAAGRRTPTPPAPAGSGG 97 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 1282 GGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GG GG G P GG G + GGGG Sbjct: 88 GGGFGGGAGGPLGGGGGGWGAGGGGGGG 115 >02_01_0302 - 2021221-2023305 Length = 694 Score = 29.9 bits (64), Expect = 5.5 Identities = 29/135 (21%), Positives = 31/135 (22%), Gaps = 12/135 (8%) Frame = +3 Query: 915 PPFKNWXPP---GNFXXGXXXXPXXXXXXLGGXXPKXPXKNXPPPPXPXGFFFXPXXXXX 1085 PP PP G + P P P N P P P P Sbjct: 400 PPAPVSSPPRRRGPYPQPPSSSPTPSYPSPSSSYPAPPGSNTPSYPSPPSSATTPSSHSP 459 Query: 1086 XGGGXXXX--FXXKGGGGGXXP----PXXXXXXXXXXXXXXXAXPP---PPXXGEXXXAP 1238 GG + GG P P P PP P Sbjct: 460 PGGSSSTTPSYPSPNGGKPSTPSHPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHTTPSHP 519 Query: 1239 XPPGGXPXPPXXXPP 1283 PP PP PP Sbjct: 520 SPPSSSTAPPSHSPP 534 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 26 PPPRTRVRPPPPPAPPPPPPP 46 >12_02_1114 - 26171876-26172493 Length = 205 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGGGGGGGGG 85 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 29.5 bits (63), Expect = 7.2 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGGXA 1193 GGG GG G GG GA S GGGG A Sbjct: 192 GGGNGGGGSG---GGGGARGSSGGGGGGGWA 219 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 1392 KGGGGXXXXPXRXXXXPPPXGXXXPPPPPXXXTGPPP 1502 +G G P PPP PPPPP GPPP Sbjct: 134 RGPGQEPPPPHVPKAAPPPP----PPPPPHAPPGPPP 166 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP GPPP Sbjct: 1129 PPPLPLDAPPPPP-LPEGPPP 1148 Score = 29.1 bits (62), Expect = 9.5 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 1440 PPPXGXXXPPPPPX--XXTGPPP 1502 PPP PPPPP +GPPP Sbjct: 1172 PPPLSPSLPPPPPPPPLPSGPPP 1194 >07_03_0560 + 19479597-19480667 Length = 356 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG GA GGGG Sbjct: 76 GGGGGLGGGGGFGGGGGAGGGGGLGGGGG 104 >06_02_0175 - 12624608-12625297 Length = 229 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 94 GGGGSSGGGGGGGGGGGGGGGGGGGGGGG 122 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 95 GGGSSGGGGGGGGGGGGGGGGGGGGGGGG 123 >03_01_0023 + 198414-198968 Length = 184 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 1297 PXXXGGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 P GGG GG G GG G S GGG Sbjct: 33 PSPGGGGGGGGGGGGGGGGRGGGGGSGGGSGGG 65 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 7.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1440 PPPXGXXXPPPPPXXXTGPPP 1502 PPP PPPPP PPP Sbjct: 367 PPPPPRPPPPPPPIKKGAPPP 387 >01_01_0082 + 625198-625719 Length = 173 Score = 24.6 bits (51), Expect(2) = 9.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 1194 AXPPPPXXGEXXXAPXPPGGXPXPPXXXPPP 1286 A PPPP P P P PP PPP Sbjct: 51 ASPPPPDV-----LPTPVYYPPPPPVYYPPP 76 Score = 23.0 bits (47), Expect(2) = 9.1 Identities = 13/37 (35%), Positives = 13/37 (35%), Gaps = 3/37 (8%) Frame = +3 Query: 1395 GGGGXXXXPXRXXX---XPPPXGXXXPPPPPXXXTGP 1496 GGGG P P P G PP P T P Sbjct: 99 GGGGYNPTPSYNPTPGYNPTPSGWFTPPNMPSYLTPP 135 >09_04_0424 + 17444261-17444665,17445974-17446367,17447367-17447425, 17447507-17447637,17447737-17447833,17447936-17448100 Length = 416 Score = 29.1 bits (62), Expect = 9.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 1395 GGGGXXXXPXRXXXXPPPXGXXXPPPP 1475 GGG P + PPP PPPP Sbjct: 9 GGGDVVQKPQQVVAAPPPPQAALPPPP 35 >06_03_1326 - 29355467-29355817 Length = 116 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 5 GGGGGGGGKGGGGGGGGGKGGGGGSGGGG 33 >06_01_0102 + 834660-834911,835460-835568,835891-836006,836116-836235, 836398-836436,836678-836811,837035-837299,837615-837698, 837943-838003,838748-838810,839174-839216,839632-839711, 839831-840267 Length = 600 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -3 Query: 1135 PPPPPXXKXXXXXPPPXXXXXXGXKKNPXGXGGGG 1031 PPPPP K PP G + G GG G Sbjct: 23 PPPPPPPKILLAKPPLPPPSSSGADDDGGGGGGAG 57 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 47 GGGGSGGGGGGGGGGGGGGGSGGGCGGGG 75 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 48 GGGSGGGGGGGGGGGGGGGSGGGCGGGGG 76 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGGXA 1193 GGG GG G GG G GGGG + Sbjct: 52 GGGGGGGGGGGGGGGSGGGCGGGGGGGGGSS 82 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 149 GGGGGGGGGGGDVGGDGGGGGDGNVGGGG 177 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1285 GGGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GGG GG G GG G GGGG Sbjct: 16 GGGGGGGGGGGGGGGVGGDRGGGGSGGGG 44 >03_05_0252 - 22403504-22404676 Length = 390 Score = 29.1 bits (62), Expect = 9.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 1282 GGXXXGGXGXPPGGXGAXXXSPXXGGGG 1199 GG GG G GG G + GGGG Sbjct: 16 GGGGGGGAGGGGGGGGGGAAAAAAGGGG 43 >01_03_0008 + 11594061-11594078,11594201-11594285,11594506-11595149 Length = 248 Score = 29.1 bits (62), Expect = 9.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 7/38 (18%) Frame = +3 Query: 1194 AXPPPPXXGEX----XXAPXP---PGGXPXPPXXXPPP 1286 A PPPP GE AP P P P P PPP Sbjct: 80 APPPPPAEGEAAPPPADAPPPEEAPAAEPAPSEAAPPP 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,110,964 Number of Sequences: 37544 Number of extensions: 1092277 Number of successful extensions: 7995 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 2624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6835 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4814874820 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -