BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_H06_e432_16.seq (1457 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1788 + 29523216-29524867,29525048-29525075 34 0.24 03_05_0067 - 20460206-20460703,20461255-20461530 33 0.43 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 32 1.3 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 31 2.3 03_05_0524 - 25181432-25181483,25181565-25181691,25181776-251818... 31 2.3 11_06_0561 - 24984960-24985205,24985283-24985354,24985906-249859... 31 3.0 02_05_0686 - 30900748-30902167,30903442-30904742 31 3.0 07_01_0862 - 7172083-7172931 30 4.0 01_06_0565 + 30287253-30287502,30287522-30289010,30289133-302892... 30 4.0 09_04_0258 - 16175258-16176069,16176111-16176414 30 5.3 09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174... 30 5.3 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 30 5.3 01_07_0239 + 42222024-42222133,42222220-42222301,42222396-422224... 30 5.3 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 7.0 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 7.0 02_05_0112 - 25931775-25932078,25932554-25932732,25934033-25935184 29 7.0 02_04_0029 + 19036176-19036481,19036602-19036733,19036814-190369... 29 7.0 01_01_0796 + 6190931-6192745 29 7.0 07_03_0965 - 22996575-22999112,22999202-22999636,22999717-229998... 29 9.2 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 9.2 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 9.2 03_05_0663 + 26546810-26547304 29 9.2 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 29 9.2 01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 29 9.2 >07_03_1788 + 29523216-29524867,29525048-29525075 Length = 559 Score = 34.3 bits (75), Expect = 0.24 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 890 APPKNXXXXGEKXPPPPPEXXXPXGXXPXPXPGKXRGXKXXPGXGGTXF 744 APPK K PPPPP P P P P G G G F Sbjct: 17 APPKRGRGRPRKNPPPPP----PPATDPNPHPPSGAGAGAGAGAGACPF 61 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 33.5 bits (73), Expect = 0.43 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 1080 PPPXWGFXXPPPXPP-XFXGAXLXFFXGGXPPPPXFXGP 1193 PPP + PPP PP F GA G PPPP P Sbjct: 16 PPPQYFQAGPPPPPPQYFQGAHPPAAMWGQPPPPQAAPP 54 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -1 Query: 890 APPKNXXXXGEKXP---PPPPEXXXPXGXXPXPXP 795 APP G+K P PPPP+ P G P P P Sbjct: 749 APPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 31.1 bits (67), Expect = 2.3 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 474 NSHR*QQKDVVLGK---KPHPLGTGGXIPKERGXEXPPKSLKGPGVP 605 N H Q +DV G+ P P G G +P++ PP S PG P Sbjct: 226 NMHNFQNRDVPPGQGFNSPPPPGQGPVLPRDAPPMPPPPSPPNPGAP 272 >03_05_0524 - 25181432-25181483,25181565-25181691,25181776-25181826, 25182159-25182314,25182405-25182905,25182999-25183713, 25183797-25183867,25183974-25184103,25185706-25186167 Length = 754 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 1080 PPPXWGFXXPPPXPPXFXGAXLXFFXGGXPPPPXFXGP 1193 PPP G PPP PP + PPPP P Sbjct: 350 PPPLHGSVMPPPLPPATVEPVISAPMVEPPPPPAMITP 387 >11_06_0561 - 24984960-24985205,24985283-24985354,24985906-24985977, 24986612-24986782,24987464-24987653,24987733-24987976, 24988162-24988474,24988687-24989517,24989628-24989672, 24989677-24989790,24989877-24990371,24990627-24990824, 24990902-24991357 Length = 1148 Score = 30.7 bits (66), Expect = 3.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 1171 GGXPPXKKXRXAPXKXGGXGGGXKXPHXGGG 1079 GG P + P GG GGG P GGG Sbjct: 53 GGSPAPRAASPPPTAAGGQGGGGGGPVSGGG 83 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 30.7 bits (66), Expect = 3.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 857 KXPPPPPEXXXPXGXXPXPXPGKXRGXKXXPGXGG 753 K PPPPP P P P GK G P GG Sbjct: 351 KGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGG 385 >07_01_0862 - 7172083-7172931 Length = 282 Score = 30.3 bits (65), Expect = 4.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 1107 PPPXPPXFXGAXLXFFXGGXPPPPXFXGPXWGLFSXGG 1220 PPP P PPPP P W L + GG Sbjct: 215 PPPSPTAAAKEEPIELEHAAPPPPFVPRPVWPLLASGG 252 >01_06_0565 + 30287253-30287502,30287522-30289010,30289133-30289277, 30289679-30289729 Length = 644 Score = 30.3 bits (65), Expect = 4.0 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -2 Query: 1222 APPXEKSPX*GPXKXGGGGXPPXKKXRXAPXKXGGXGGGXKXP 1094 APP +P P GGG PP +P GG GG P Sbjct: 88 APPCAPTP---PQGGGGGYNPPSPSIGTSPTTPGGGGGYTPTP 127 >09_04_0258 - 16175258-16176069,16176111-16176414 Length = 371 Score = 29.9 bits (64), Expect = 5.3 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -2 Query: 1216 PXEKSPX*GPXKXGGGGXPPXKKXRXAPXKXGGXGGGXKXPHXGGGXKI 1070 P S P + GGG PP R GG P GGG I Sbjct: 205 PEATSSSARPARAGGGASPPPLPVRVGASTPPPPHGGAGLPEVGGGAAI 253 >09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052, 1741559-1741641,1741733-1741784,1742038-1742105, 1742279-1742345,1742426-1742505,1742576-1742640, 1742785-1742847,1743271-1743427,1743511-1743588, 1743677-1744219,1744321-1744497,1744534-1744788, 1745270-1745329,1745874-1745888,1746123-1746135, 1746819-1746934 Length = 793 Score = 29.9 bits (64), Expect = 5.3 Identities = 19/58 (32%), Positives = 23/58 (39%) Frame = -2 Query: 1177 GGGGXPPXKKXRXAPXKXGGXGGGXKXPHXGGGXKIRXPXKNPLXFFPRXXKKNXGGG 1004 GG G PP + R GG GGG GGG P + P ++ GGG Sbjct: 41 GGSGSPPHRFSR------GGGGGGGDGGGGGGGGGRFHPYRGPSDHSGGGGYRSGGGG 92 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.9 bits (64), Expect = 5.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 1080 PPPXWGFXXPPPXPPXFXGAXLXFFXGGXPPPPXFXG 1190 PPP G PP PP G F GG PPP G Sbjct: 1150 PPPPVGGLGGPPAPPPPAG-----FRGGTPPPNAHGG 1181 >01_07_0239 + 42222024-42222133,42222220-42222301,42222396-42222486, 42222702-42222814,42222912-42222984,42223080-42223178, 42223201-42223406,42223693-42223832,42223912-42223969, 42224067-42224137,42224207-42224741 Length = 525 Score = 29.9 bits (64), Expect = 5.3 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 Query: 1170 GXXPXKKX*XGPPEXGGGGXGXXKXPTXGGGXKF 1069 G P + GPP GGG G P GGG + Sbjct: 453 GSGPYPQQGRGPPPYPGGGMGGAGGPRGGGGSGY 486 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.5 bits (63), Expect = 7.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 886 PXKTXXXXGKXXPPPPRXGXXPXVFXPXPPQGKXGG 779 P T PPPPR P P PP GK GG Sbjct: 603 PSATANTASALPPPPPRPPGAP---PPPPPPGKPGG 635 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 29.5 bits (63), Expect = 7.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 1080 PPPXWGFXXPPPXPPXFXGAXLXFFXGGXPPPPXFXGPXWGLF 1208 PPP P PP GA GG P PP P +F Sbjct: 655 PPPAPPIAGAAPPPPMANGAAAAAPPGGNPAPPAGPQPGVNMF 697 >02_05_0112 - 25931775-25932078,25932554-25932732,25934033-25935184 Length = 544 Score = 29.5 bits (63), Expect = 7.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 1074 FXPPPXWGFXXPPPXPPXFXGAXLXFFXGGXPPPPXFXG 1190 F PPP + P P PP F G L G P G Sbjct: 287 FSPPPAL-YASPTPSPPTFAGGYLQSRLSGETAPMIIPG 324 >02_04_0029 + 19036176-19036481,19036602-19036733,19036814-19036933, 19037763-19037837,19038282-19038392,19038528-19038635, 19038865-19038933,19038934-19039004,19039095-19039147, 19039223-19039326,19039424-19039696 Length = 473 Score = 29.5 bits (63), Expect = 7.0 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -1 Query: 884 PKNXXXXGEKXPPPPPEXXXPXGXXPXPXPGKXRGXKXXPGXGG 753 P + PPPP P P P P G PG GG Sbjct: 32 PTSAAAAAADVPPPPSSSSSP----PPPPPSSVEGRTKQPGGGG 71 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.5 bits (63), Expect = 7.0 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 1080 PPPXWGFXXPPPXPPXFXGAXLXFFXGGXPPPPXFXGPXWGL 1205 PPP PPP PP G+ + PPPP P GL Sbjct: 229 PPPFVADQPPPPPPPAAGGS---LWIPELPPPPVEGSPWAGL 267 >07_03_0965 - 22996575-22999112,22999202-22999636,22999717-22999801, 22999888-22999957,23000050-23000293,23000396-23000482, 23000655-23000706,23000830-23001226,23001324-23001648, 23001748-23001914,23002007-23002547 Length = 1646 Score = 29.1 bits (62), Expect = 9.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 1192 GPXKXGGGGXPPXKKXRXAPXKXGGXGGGXKXP 1094 G GGGG PP + R GG G G P Sbjct: 12 GVSGGGGGGGPPPPRRRLRSSGGGGGGSGSGGP 44 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 29.1 bits (62), Expect = 9.2 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +3 Query: 1080 PPPXWGFXXPPPXPPXFXGAXL------XFFXGGXPPPPXFXG 1190 PPP + PPP PP G L + PPPP + G Sbjct: 10 PPPHSSYAAPPPPPPPPPGTSLYASYRHHAYPPHPPPPPAYVG 52 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.1 bits (62), Expect = 9.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -1 Query: 890 APPKNXXXXGEKXPPPPPEXXXPXGXXPXPXPG 792 AP + G PPPPP P P PG Sbjct: 337 APSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPG 369 >03_05_0663 + 26546810-26547304 Length = 164 Score = 29.1 bits (62), Expect = 9.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 1201 PX*GPXKXGGGGXPPXKKXRXAPXKXGGXGGGXKXPHXGGG 1079 P P GGGG P P GG GG P GGG Sbjct: 52 PGTNPGGGGGGGIPTIPGFGSIPGMGGGM-GGFNVPGMGGG 91 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 29.1 bits (62), Expect = 9.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 1080 PPPXWGFXXPPPXPPXFXGAXLXFFXGGXPPPP 1178 PPP G PPP PP + + G PPPP Sbjct: 30 PPPPMGPPPPPPMPP----VPVMYLRGVPPPPP 58 >01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 Length = 301 Score = 29.1 bits (62), Expect = 9.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 1189 PXKXGGGGXPPXKKXRXAPXKXGGXGGGXKXPHXGGG 1079 P GG G P P GG GGG P GGG Sbjct: 110 PSHGGGYGASPP----VTPSPGGGYGGGSPAPSHGGG 142 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,620,695 Number of Sequences: 37544 Number of extensions: 807918 Number of successful extensions: 4686 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4322 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4640843200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -