BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_H01_e392_15.seq (1527 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RQR5 Cluster: Drosophila melanogaster LD33051p; n=3; ... 36 3.7 >UniRef50_Q7RQR5 Cluster: Drosophila melanogaster LD33051p; n=3; Plasmodium (Vinckeia)|Rep: Drosophila melanogaster LD33051p - Plasmodium yoelii yoelii Length = 939 Score = 35.5 bits (78), Expect = 3.7 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 8/86 (9%) Frame = +3 Query: 441 NRFYIMTTDNLN*LTEIYINASEAVV--KN*CYTALLL------KPYQYYIDFV*YLSIL 596 N I +++N + E+Y + V+ KN Y ++LL K + YID++ Y+ IL Sbjct: 232 NLLMIKNKEDINYVEELYFLCCQLVIQYKNNLYPSILLSIVKTFKQIKKYIDYIKYIQIL 291 Query: 597 FYENELFSMKIKYDIINPPCHSPIII 674 Y +++ KIK I C S I+I Sbjct: 292 IYMSDISIHKIKGYIYK--CVSNIVI 315 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,196,613,857 Number of Sequences: 1657284 Number of extensions: 21751939 Number of successful extensions: 35646 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 32577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35469 length of database: 575,637,011 effective HSP length: 104 effective length of database: 403,279,475 effective search space used: 162924907900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -