SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030905E5_G12_e479_14.seq
         (1522 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6DED8 Cluster: Putative uncharacterized protein; n=1; ...    35   6.5  

>UniRef50_A6DED8 Cluster: Putative uncharacterized protein; n=1;
           Caminibacter mediatlanticus TB-2|Rep: Putative
           uncharacterized protein - Caminibacter mediatlanticus
           TB-2
          Length = 646

 Score = 34.7 bits (76), Expect = 6.5
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 3/68 (4%)
 Frame = +2

Query: 407 NLISPNISSYSH*FIHSTMLLLRTRFHPLVVSTGGAGLRVFFC---KLKNKG*PLRLFIY 577
           NL   N S Y H  IH++ L+  + F   V ST   G  +F+    K +  G PLR  I+
Sbjct: 540 NLNEFNFSFYLHGHIHNSSLIQLSNFAFAVNSTISIGAGLFYAYNDKARVLGVPLRYNIF 599

Query: 578 TYRFKRNK 601
           T   K NK
Sbjct: 600 TLTIKDNK 607


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 728,538,146
Number of Sequences: 1657284
Number of extensions: 11171378
Number of successful extensions: 21296
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 20562
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21270
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 162118348950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -