BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_G12_e479_14.seq (1522 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_25744| Best HMM Match : MFS_1 (HMM E-Value=9.7e-23) 30 5.6 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 725 ITIXWPPFYXRGXWGNPXGXXXXXLXXXPLF 817 ITI WP FY R W NP L P F Sbjct: 25 ITIHWPSFYKRRDWENPGVNQLNRLAAHPPF 55 >SB_25744| Best HMM Match : MFS_1 (HMM E-Value=9.7e-23) Length = 403 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 447 LYTRLCFCCGLAFIPLWFRQ 506 L T LCFC GL IP++F + Sbjct: 121 LGTSLCFCSGLGIIPMYFEK 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,627,100 Number of Sequences: 59808 Number of extensions: 361411 Number of successful extensions: 2139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2139 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4941604117 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -