BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_G09_e455_13.seq (1566 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 5.9 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 25 7.9 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.0 bits (52), Expect = 5.9 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -1 Query: 1194 GXGGSXGXXXSXCQXVLGGSFXXGXAXGXSGNLNSIXXRNLXIFESS 1054 G GG+ G GGS G + G SG +S R+ I SS Sbjct: 840 GGGGAGGPLRGSSGGAGGGSSGGGGSGGTSGGGSSTTRRDHNIDYSS 886 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 24.6 bits (51), Expect = 7.9 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 378 CTAPSVFQRFINDVFQDLILDGTVLSYLDDLILSFKY--EYEGFLKLEMVFK 527 C +F RF NDV V S+ D + F+Y + F +L++ K Sbjct: 175 CEVKDLFIRFTNDVIASCAFGVHVNSFRDKDNVFFRYGKDLSNFSRLKVALK 226 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,169,743 Number of Sequences: 2352 Number of extensions: 22041 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 184503330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -