Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030905E5_G08_e447_14.seq
         (1579 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PG...    29   6.4  

>At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PGP1)
           identical to P-glycoprotein GI:3849833 from [Arabidopsis
           thaliana]; homologous to mammalian mdr gene,contains
           ATP-binding cassette; related to multi drug resistance
           proteins
          Length = 1286

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 14/42 (33%), Positives = 23/42 (54%)
 Frame = -3

Query: 263 IVQSTCSLQLEYVFHVIMTVYSYNYDHRIFLYVLDKYFGCYV 138
           ++  + S    YV   +++VY YN DH   +  +DKY  CY+
Sbjct: 708 VICGSLSAFFAYVLSAVLSVY-YNPDHEYMIKQIDKY--CYL 746


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,891,652
Number of Sequences: 28952
Number of extensions: 404389
Number of successful extensions: 678
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 644
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 678
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4250619072
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)