BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_G07_e439_13.seq (1546 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 25 1.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 3.5 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 25.4 bits (53), Expect = 1.1 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +2 Query: 479 EEKEEELRDLYADLNHKLSIANN*TMD-LKGSLVDTKLKIYPTKPLL 616 E+ +ELRD++ D + ++ + M L+ L++T L++YP P++ Sbjct: 20 EKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLET-LRMYPPVPII 65 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -1 Query: 475 CVINSLTFKIHIINKLVPFTLSFIMIFCSLFFTYLLFIKTIPFNYFT 335 CV+ L + + FT+ +++ C +F Y+ + F FT Sbjct: 230 CVLIILLCIYYFYYAFILFTVHLLLLVCIYYFYYMHLLFCCAFIIFT 276 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 264,742 Number of Sequences: 336 Number of extensions: 5062 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46500950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -