BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_G04_e415_14.seq (1570 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 24 3.5 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 3.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 6.2 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 750 PLSPAGVIAKRPAPIALXNSCA 815 P P GV KR P AL +CA Sbjct: 52 PCPPQGVDLKRVLPEALQTNCA 73 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 3.5 Identities = 22/72 (30%), Positives = 33/72 (45%) Frame = -3 Query: 404 PALGVLHVLDADVDAFR*DPAADALVHDHAESVCGHIVNTPCLTVVYFVWHTLLYSAIAP 225 P L H +DA + F + + +++ E C H+VN P TVV V L+ A Sbjct: 476 PLLSQRHQIDAKM--FCNESSVSNCENEYCE--CTHVVNIPLGTVVEMV---LIDKGYAY 528 Query: 224 NVNDVSHFVHFH 189 + N H +H H Sbjct: 529 DANHPFH-LHGH 539 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 255 PHKVYHGKTGR 287 PH Y GKTGR Sbjct: 302 PHPTYFGKTGR 312 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 268,791 Number of Sequences: 336 Number of extensions: 4842 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 47320350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -