BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_G02_e399_14.seq (1549 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 26 0.65 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 6.1 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 26.2 bits (55), Expect = 0.65 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 251 HPGA*CSPMTSCWSVRVDKRCKTD 322 +P A C+ T CW V +D C D Sbjct: 523 NPWANCTASTRCWEVFMDGICNED 546 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 581 SWSHKSDTCCQFIPPELILCLISRSISPSHCRSDHEVAE 465 SWS K +F P ++ L + I DH++AE Sbjct: 530 SWSQKRPGAGKFTPEDINPSLCTHIIYAFATLKDHKLAE 568 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,119 Number of Sequences: 336 Number of extensions: 4764 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46603375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -