BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_G01_e391_13.seq (1578 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 43 6e-04 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 38 0.029 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 38 0.029 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 38 0.029 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.089 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.16 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 35 0.16 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.16 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 35 0.16 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.16 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 34 0.27 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.36 SB_44498| Best HMM Match : BA14K (HMM E-Value=7) 33 0.48 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.63 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.63 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 32 1.1 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.1 SB_45332| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.5 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 31 1.9 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 31 1.9 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 31 1.9 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 31 1.9 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 31 1.9 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 31 1.9 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 31 1.9 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_16615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 31 1.9 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 31 1.9 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 31 2.5 SB_29389| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_12156| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 31 3.4 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 31 3.4 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 31 3.4 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 31 3.4 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 31 3.4 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 31 3.4 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 31 3.4 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 31 3.4 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 31 3.4 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 31 3.4 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 31 3.4 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 31 3.4 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 31 3.4 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 31 3.4 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 31 3.4 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 31 3.4 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 31 3.4 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 31 3.4 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 31 3.4 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 31 3.4 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 31 3.4 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 31 3.4 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 31 3.4 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 31 3.4 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 31 3.4 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 31 3.4 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 31 3.4 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 31 3.4 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 31 3.4 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 31 3.4 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 31 3.4 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 31 3.4 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 31 3.4 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 31 3.4 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 31 3.4 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 31 3.4 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 31 3.4 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 31 3.4 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 31 3.4 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 31 3.4 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 31 3.4 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 31 3.4 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 31 3.4 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 31 3.4 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 31 3.4 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 31 3.4 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 31 3.4 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.4 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.0 bits (109), Expect = 2e-05 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -3 Query: 973 SWVXPGFPSHXVVKRRPXXCXXTHXR 896 SWV PGFPSH VVKRRP C TH R Sbjct: 52 SWVTPGFPSHDVVKRRPVNCNTTHYR 77 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 43.2 bits (97), Expect = 6e-04 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 881 GPHFXPXVSXXTXXWPXFYNXVTGKPWRYPTXSPWRX-PPFAXWXXSEKA 1027 G P VS T WP FYN TGK Y + PPFA W S++A Sbjct: 37 GAPIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEA 86 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/42 (47%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPT-XSPWRXPPFAXWXXSEKA 1027 S T WP FYN VTGK P + PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEA 43 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/42 (47%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPTXSPWR-XPPFAXWXXSEKA 1027 S T WP FYN VTGK P + PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEA 43 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPTXSPWRX-PPFAXWXXSEKA 1027 S T WP FYN VTGK P PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEA 43 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 1027 GLFAXXXXXXXXXXXXGXSWVXPGFPSHXVVKRRPXXCXXTHXR 896 GLFA V P FPSH VVKRRP C TH R Sbjct: 1853 GLFAITPAGERGMCCKAIKLVTPVFPSHDVVKRRPVNCNTTHYR 1896 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 38.3 bits (85), Expect = 0.017 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPTXSPWRX-PPFAXWXXSEKA 1027 S T WP FYN VTGK + PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEA 43 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.3 bits (85), Expect = 0.017 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGK-PWRYPTXSPWRXPPFAXWXXSEKA 1027 S T WP FYN VTGK P PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEA 43 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 37.5 bits (83), Expect = 0.029 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH VVKRRP C TH R Sbjct: 1 GFPSHDVVKRRPVNCNTTHYR 21 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 37.5 bits (83), Expect = 0.029 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH VVKRRP C TH R Sbjct: 57 GFPSHDVVKRRPVNCNTTHYR 77 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 37.5 bits (83), Expect = 0.029 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH VVKRRP C TH R Sbjct: 625 GFPSHDVVKRRPVNCNTTHYR 645 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.5 bits (83), Expect = 0.029 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH VVKRRP C TH R Sbjct: 36 GFPSHDVVKRRPVNCNTTHYR 56 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 37.5 bits (83), Expect = 0.029 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH VVKRRP C TH R Sbjct: 79 GFPSHDVVKRRPVNCNTTHYR 99 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.5 bits (83), Expect = 0.029 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPTXSPWRX-PPFAXWXXSEKA 1027 S T WP FYN VTGK + PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEA 43 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 37.5 bits (83), Expect = 0.029 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH VVKRRP C TH R Sbjct: 68 GFPSHDVVKRRPVNCNTTHYR 88 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 37.5 bits (83), Expect = 0.029 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH VVKRRP C TH R Sbjct: 68 GFPSHDVVKRRPVNCNTTHYR 88 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.5 bits (83), Expect = 0.029 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPTXSPWRX-PPFAXWXXSEKA 1027 S T WP FYN VTGK + PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEA 43 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 35.9 bits (79), Expect = 0.089 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 923 WPXFYNXVTGKPWRYPTXSPWRX-PPFAXWXXSEKA 1027 WP FYN VTGK + PPFA W SE+A Sbjct: 6 WPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEA 41 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 35.1 bits (77), Expect = 0.16 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 923 WPXFYNXVTGKPWRYPT-XSPWRXPPFAXWXXSEKA 1027 WP FYN VTGK P + P FA W S++A Sbjct: 6 WPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEA 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 955 FPSHXVVKRRPXXCXXTHXR 896 FPSH VVKRRP C TH R Sbjct: 39 FPSHDVVKRRPVNCNTTHYR 58 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 955 FPSHXVVKRRPXXCXXTHXR 896 FPSH VVKRRP C TH R Sbjct: 37 FPSHDVVKRRPVNCNTTHYR 56 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 955 FPSHXVVKRRPXXCXXTHXR 896 FPSH VVKRRP C TH R Sbjct: 31 FPSHDVVKRRPVNCNTTHYR 50 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 35.1 bits (77), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 955 FPSHXVVKRRPXXCXXTHXR 896 FPSH VVKRRP C TH R Sbjct: 45 FPSHDVVKRRPVNCNTTHYR 64 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 34.3 bits (75), Expect = 0.27 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +2 Query: 881 GPHFXPXVSXXTXXWPXFYNXVTGKPWRYPTXSPWRXPPFAXWXXSEKA 1027 G P VS T WP FYN VT PPFA W SE+A Sbjct: 39 GAPIRPIVSHITIHWPSFYNGVTA------------HPPFASWRNSEEA 75 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGK-PWRYPTXSPWRXPPFAXWXXSEKA 1027 S T WP FYN + K P PPFA W SEKA Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKA 43 >SB_44498| Best HMM Match : BA14K (HMM E-Value=7) Length = 146 Score = 33.5 bits (73), Expect = 0.48 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 880 RXPFXPXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 R P SE + SLA VLQ RDWE LE P Sbjct: 15 RSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLEAHP 53 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.5 bits (73), Expect = 0.48 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPTXSPWR-XPPFAXWXXSEKA 1027 S T WP FYN VTGK P R P +A SE+A Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEA 43 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 33.5 bits (73), Expect = 0.48 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 1028 GPFRYXXXXQKGDXSKGXXLGXAR-VSQSRXCKTXAXE 918 GP RY +KGD + G SQSR CKT A E Sbjct: 41 GPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASE 78 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.1 bits (72), Expect = 0.63 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 896 PXVSXXTXXWPXFYNXVTGKPWRYPTXSPWRX----PPFAXWXXSEKA 1027 P VS T WP FY + W P + PPFA W SE+A Sbjct: 20 PIVSRITIHWPSFYKR---RDWENPGVNQLNRLAAHPPFASWRSSEEA 64 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 33.1 bits (72), Expect = 0.63 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGK-PWRYPTXSPWRXPPF-AXWXXSEKA 1027 S T WP FYN VTGK R P+ + P A W SE+A Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEA 44 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 32.3 bits (70), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 958 GFPSHXVVKRRPXXCXXTHXR 896 GFPSH KRRP C TH R Sbjct: 75 GFPSHDGEKRRPVNCNTTHYR 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 1.1 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 896 PXVSXXTXXWPXFYNXVTGKPWRYP 970 P +S T WP FYN VTGK P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALP 101 >SB_45332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 923 WPXFYNXVTGKPWRYPTXSPW--RXPPFAXWXXSEKA 1027 W FY K R T PW PPFA W SE+A Sbjct: 2 WQPFYKNENQKMVRVLTMVPWLGSHPPFASWRNSEEA 38 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 33 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 66 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 45 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 78 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 42 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 75 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 43 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 76 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 48 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 81 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 37 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 70 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 86 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 119 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 28 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 61 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.5 bits (68), Expect = 1.9 Identities = 21/62 (33%), Positives = 27/62 (43%) Frame = +1 Query: 769 ISLNVRLFKFCIFXLXF*IRTFLNPYEXXXXXTXGGXRXPFXPXSEXFXXSLAXVLQXRD 948 IS N+ + FCI + F +P + P SE + SLA VLQ RD Sbjct: 9 ISANILTYSFCI--VEFPGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRD 66 Query: 949 WE 954 WE Sbjct: 67 WE 68 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 26 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 59 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 506 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 539 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 58 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 91 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 27 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 60 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 40 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 73 >SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 27 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 60 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 46 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 79 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 62 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 95 >SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 1356 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 1389 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 180 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 213 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +2 Query: 905 SXXTXXWPXFYNXVTGKPWRYPTXSPWRX----PPFAXWXXSEKA 1027 S T WP FYN V W P + PPFA W SE+A Sbjct: 2 SRITIHWPSFYNVVH---WENPGVTQLNRLAAHPPFASWRNSEEA 43 >SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 39 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 72 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 28 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 61 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 81 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 114 >SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 38 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 71 >SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 56 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 89 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 79 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 112 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 44 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 77 >SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 88 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 121 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 32 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 65 >SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 36 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 69 >SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 42 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 75 >SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 29 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 62 >SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 66 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 99 >SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.5 bits (68), Expect = 1.9 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 955 FPSHXVVKRRPXXCXXTHXR 896 F SH VVKRRP C TH R Sbjct: 19 FRSHDVVKRRPVNCNTTHYR 38 >SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 47 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 80 >SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 151 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 184 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 41 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 74 >SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 109 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 142 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 96 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 129 >SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 61 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 94 >SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 26 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 59 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 48 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 81 >SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 35 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 68 >SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 31 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 64 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 34 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 67 >SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 114 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 147 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 604 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 637 >SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 96 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 129 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 76 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 109 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 129 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 162 >SB_16615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVSQLNRLAAHP 53 >SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 1028 GPFRYXXXXQKGDXSKGXXLGXAR-VSQSRXCKTXAXE 918 GP RY +KGD +G SQSR CKT A E Sbjct: 12 GPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASE 49 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 39 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 72 >SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 183 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 216 >SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 32 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 65 >SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 37 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 70 >SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 45 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 78 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 60 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 93 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 38 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 71 >SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 29 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 62 >SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 26 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 59 >SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 29 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 62 >SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 20 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 44 PYSESYYNSLAVVLQRRDWENTGVTQLNRLAAHP 77 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 136 PYSESYYNSLAVVLQRRDWENTGVSQVIRLAVHP 169 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 31.1 bits (67), Expect = 2.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 956 PWRYPTXSPWRXPPFAXWXXSEKA 1027 P R+ + SP+ PPFA W SE+A Sbjct: 48 PPRWSSNSPYTHPPFASWRNSEEA 71 >SB_29389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 880 RXPFXPXSEXFXXSLAXVLQXRDWE 954 R P SE + SLA VLQ RDWE Sbjct: 15 RSSNSPYSESYYNSLAVVLQRRDWE 39 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWETLAXPNXXPLEXSP 996 P SE + SLA VLQ RDWE L P Sbjct: 140 PYSESYYNSLAVVLQRRDWENTGVSQVIRLAVHP 173 >SB_12156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 823 IRTFLNPYEXXXXXTXGGXRXPFXPXSEXFXXSLAXVLQXRDWE 954 + TF++P + P SE + SLA VLQ RDWE Sbjct: 92 VETFVSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWE 135 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 35 PYSESYYNSLAVVLQRRDWE 54 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 58 PYSESYYNSLAVVLQRRDWE 77 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 49 PYSESYYNSLAVVLQRRDWE 68 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 26 PYSESYYNSLAVVLQRRDWE 45 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 41 PYSESYYNSLAVVLQRRDWE 60 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 50 PYSESYYNSLAVVLQRRDWE 69 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 31 PYSESYYNSLAVVLQRRDWE 50 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 207 PYSESYYNSLAVVLQRRDWE 226 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 102 PYSESYYNSLAVVLQRRDWE 121 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 38 PYSESYYNSLAVVLQRRDWE 57 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 372 PYSESYYNSLAVVLQRRDWE 391 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 30 PYSESYYNSLAVVLQRRDWE 49 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 29 PYSESYYNSLAVVLQRRDWE 48 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 36 PYSESYYNSLAVVLQRRDWE 55 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 331 PYSESYYNSLAVVLQRRDWE 350 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 71 PYSESYYNSLAVVLQRRDWE 90 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 41 PYSESYYNSLAVVLQRRDWE 60 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 50 PYSESYYNSLAVVLQRRDWE 69 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 34 PYSESYYNSLAVVLQRRDWE 53 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 125 PYSESYYNSLAVVLQRRDWE 144 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 54 PYSESYYNSLAVVLQRRDWE 73 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 30 PYSESYYNSLAVVLQRRDWE 49 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 58 PYSESYYNSLAVVLQRRDWE 77 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 247 PYSESYYNSLAVVLQRRDWE 266 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 27 PYSESYYNSLAVVLQRRDWE 46 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 105 PYSESYYNSLAVVLQRRDWE 124 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 25 PYSESYYNSLAVVLQRRDWE 44 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 387 PYSESYYNSLAVVLQRRDWE 406 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 110 PYSESYYNSLAVVLQRRDWE 129 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 405 PYSESYYNSLAVVLQRRDWE 424 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 47 PYSESYYNSLAVVLQRRDWE 66 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 37 PYSESYYNSLAVVLQRRDWE 56 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 54 PYSESYYNSLAVVLQRRDWE 73 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 176 PYSESYYNSLAVVLQRRDWE 195 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 25 PYSESYYNSLAVVLQRRDWE 44 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 31 PYSESYYNSLAVVLQRRDWE 50 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 45 PYSESYYNSLAVVLQRRDWE 64 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 42 PYSESYYNSLAVVLQRRDWE 61 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 26 PYSESYYNSLAVVLQRRDWE 45 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 40 PYSESYYNSLAVVLQRRDWE 59 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 30 PYSESYYNSLAVVLQRRDWE 49 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 75 PYSESYYNSLAVVLQRRDWE 94 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 331 PYSESYYNSLAVVLQRRDWE 350 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 77 PYSESYYNSLAVVLQRRDWE 96 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 27 PYSESYYNSLAVVLQRRDWE 46 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 285 PYSESYYNSLAVVLQRRDWE 304 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 48 PYSESYYNSLAVVLQRRDWE 67 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 402 PYSESYYNSLAVVLQRRDWE 421 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 42 PYSESYYNSLAVVLQRRDWE 61 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 34 PYSESYYNSLAVVLQRRDWE 53 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 84 PYSESYYNSLAVVLQRRDWE 103 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 202 PYSESYYNSLAVVLQRRDWE 221 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 34 PYSESYYNSLAVVLQRRDWE 53 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 34 PYSESYYNSLAVVLQRRDWE 53 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 36 PYSESYYNSLAVVLQRRDWE 55 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 26 PYSESYYNSLAVVLQRRDWE 45 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 186 PYSESYYNSLAVVLQRRDWE 205 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 44 PYSESYYNSLAVVLQRRDWE 63 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 77 PYSESYYNSLAVVLQRRDWE 96 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 40 PYSESYYNSLAVVLQRRDWE 59 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 178 PYSESYYNSLAVVLQRRDWE 197 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 58 PYSESYYNSLAVVLQRRDWE 77 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 41 PYSESYYNSLAVVLQRRDWE 60 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 20 PYSESYYNSLAVVLQRRDWE 39 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.7 bits (66), Expect = 3.4 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 895 PXSEXFXXSLAXVLQXRDWE 954 P SE + SLA VLQ RDWE Sbjct: 67 PYSESYYNSLAVVLQRRDWE 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,083,611 Number of Sequences: 59808 Number of extensions: 466416 Number of successful extensions: 6772 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6757 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5164621880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -