BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_F11_e470_11.seq (1498 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 5.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 5.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 5.8 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +2 Query: 299 GGCDFILDRIGAFFQD-DVRASHTSP--PGHLRSQPAI 403 G DF+ D A FQD ++ + +P PG+ + ++ Sbjct: 80 GSVDFLFDNFSAAFQDHNIEITEVAPVLPGNYANASSV 117 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +2 Query: 299 GGCDFILDRIGAFFQD-DVRASHTSP--PGHLRSQPAI 403 G DF+ D A FQD ++ + +P PG+ + ++ Sbjct: 313 GSVDFLFDNFSAAFQDHNIEITEVAPVLPGNYANASSV 350 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +2 Query: 299 GGCDFILDRIGAFFQD-DVRASHTSP--PGHLRSQPAI 403 G DF+ D A FQD ++ + +P PG+ + ++ Sbjct: 313 GSVDFLFDNFSAAFQDHNIEITEVAPVLPGNYANASSV 350 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,430 Number of Sequences: 336 Number of extensions: 4010 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 44862150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -