BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_F09_e454_11.seq (1563 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 23 8.1 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 23 8.1 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 23 8.1 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 373 KIEILIYINRVSGLGVTAASRLHRARDMRNY 281 +I + IN ++G+G T + RD +NY Sbjct: 108 RIYVDTVINHMTGMGGTGTAGSQADRDGKNY 138 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 373 KIEILIYINRVSGLGVTAASRLHRARDMRNY 281 +I + IN ++G+G T + RD +NY Sbjct: 109 RIYVDTVINHMTGMGGTGTAGSQADRDGKNY 139 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 373 KIEILIYINRVSGLGVTAASRLHRARDMRNY 281 +I + IN ++G+G T + RD +NY Sbjct: 109 RIYVDTVINHMTGMGGTGTAGSQADRDGKNY 139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 271,543 Number of Sequences: 336 Number of extensions: 5196 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 47115500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -