BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_F09_e454_11.seq (1563 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0184 + 13947739-13947930,13948289-13948465,13948546-139486... 31 2.5 >08_02_0184 + 13947739-13947930,13948289-13948465,13948546-13948665, 13948709-13948753,13948848-13949012,13949324-13949402, 13949552-13949631,13950548-13950616,13950948-13951031 Length = 336 Score = 31.1 bits (67), Expect = 2.5 Identities = 23/86 (26%), Positives = 41/86 (47%) Frame = -3 Query: 370 IEILIYINRVSGLGVTAASRLHRARDMRNYINLNCYKITIIHNMLLISTPESYAGYIVIA 191 ++I ++ LG+TA +H R+M +N++ ++ I+N S ++V Sbjct: 214 LDIKYFLRICKELGMTALIEVHDEREMERVLNISGVQLIGINN-------RSLETFVVDT 266 Query: 190 TGRRLSLCAHCD*AEIDKILVV*ESG 113 + ++ L H D ILVV ESG Sbjct: 267 SNTKMLLDMHGDTIREKGILVVGESG 292 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,487,385 Number of Sequences: 37544 Number of extensions: 533601 Number of successful extensions: 740 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5046916980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -