BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_F08_e446_12.seq (1590 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 3.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 8.3 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.8 bits (49), Expect = 3.6 Identities = 15/74 (20%), Positives = 25/74 (33%) Frame = +3 Query: 687 HAEGVLLAADETDSXSLHFEGGPASHFLVTLLDY*NIQRAEETLAX*CRSPIPGSQSTFC 866 + E VL+ D+T++ H + + ET+ +PG T Sbjct: 943 NTERVLVPGDQTEAGVFTLRPATTYHIRIVAENEIGSSEPSETVTIITAEEVPGGPPTSI 1002 Query: 867 RVVRGXCXGGLXYW 908 RV + YW Sbjct: 1003 RVETNDQHSLVVYW 1016 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.6 bits (46), Expect = 8.3 Identities = 10/45 (22%), Positives = 13/45 (28%) Frame = +2 Query: 1379 IHGXXXAPTPPPTGXXXRGRXXXXSXXXXPXXPPPRRPXXGXPPS 1513 ++G +PPP PPP G P S Sbjct: 2 MNGGIYEESPPPAPQSAATPISSSGMTSPAAAPPPATTSSGSPAS 46 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 275,295 Number of Sequences: 336 Number of extensions: 5169 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 48037325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -