BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_F07_e438_11.seq (1597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 24 2.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 8.3 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 24.2 bits (50), Expect = 2.7 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +1 Query: 571 ILYKSAPLMAGYLMDWFVER---ERKQYLKYIIKSYVLKFLINF*TFKLLL 714 ILY S ++ Y+ + F ++KQY+ ++ + + F+IN T L+L Sbjct: 220 ILYSSL-MVLNYIDEVFNNNFGYDKKQYIGVVVANVGVAFMINVGTVTLIL 269 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 8.3 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -2 Query: 312 SNPCMGFIYFNCKTVTNTLHC 250 SNPC +C + N HC Sbjct: 304 SNPCSNAGTLDCVQLVNDYHC 324 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 273,254 Number of Sequences: 336 Number of extensions: 5274 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 48242175 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -