BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_F06_e430_12.seq (1598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 149 2e-48 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 84 3e-16 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 72 1e-12 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 70 6e-12 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 70 6e-12 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 70 6e-12 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 70 6e-12 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 70 6e-12 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) 70 6e-12 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 70 6e-12 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 8e-12 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 69 1e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 69 1e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 69 1e-11 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 68 2e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 68 2e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 67 3e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 67 3e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 67 3e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 67 3e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 67 3e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 67 3e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 67 3e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 67 3e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 67 3e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 67 3e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 67 3e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 67 3e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 67 3e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 67 3e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 67 3e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 67 3e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 67 3e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 67 3e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 67 3e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 67 3e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 67 3e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 67 3e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 67 3e-11 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 67 3e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 67 3e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 67 3e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 67 3e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 67 3e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 67 3e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 67 3e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 67 3e-11 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 67 3e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 67 3e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 67 3e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 67 3e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 67 3e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 67 3e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 67 3e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 67 3e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 67 3e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 67 3e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 67 3e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 67 3e-11 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 67 3e-11 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 67 3e-11 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 67 3e-11 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 67 3e-11 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 67 3e-11 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 67 4e-11 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 66 1e-10 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 66 1e-10 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 66 1e-10 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 66 1e-10 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 66 1e-10 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 66 1e-10 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 66 1e-10 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 66 1e-10 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 66 1e-10 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 66 1e-10 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 66 1e-10 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 66 1e-10 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 65 1e-10 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 65 1e-10 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 65 1e-10 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 65 2e-10 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 65 2e-10 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 64 2e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 64 2e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 64 2e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 64 2e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 64 2e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 64 2e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 64 2e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 64 2e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 64 2e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 64 2e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 64 2e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 64 2e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 64 2e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 64 2e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 64 2e-10 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 64 2e-10 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 64 2e-10 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 64 2e-10 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 64 2e-10 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 64 2e-10 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 64 2e-10 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 64 2e-10 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 64 2e-10 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 64 2e-10 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 64 2e-10 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 64 2e-10 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 64 2e-10 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 149 bits (362), Expect(2) = 2e-48 Identities = 74/114 (64%), Positives = 92/114 (80%) Frame = +2 Query: 89 STKILKAGAIEPDTFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 268 S KI+K + FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 269 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 430 +P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 68 VPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 62.5 bits (145), Expect(2) = 2e-48 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 542 HLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFP 643 HLDK QQTTI+HK++TF +VYKKLTG++V FEFP Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 83.8 bits (198), Expect = 3e-16 Identities = 39/57 (68%), Positives = 42/57 (73%) Frame = +2 Query: 758 LQFHWPSFYNVVTGKPLAVTQLXSPCSTFPLSPAGXIXKRPAPIALPNSLRSLNGEW 928 + HWPSFYNVVTGK LA+ L + PLSPAG I KRPAPIALP LRSLNGEW Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIA-LQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 71.7 bits (168), Expect = 1e-12 Identities = 35/61 (57%), Positives = 41/61 (67%) Frame = -3 Query: 921 PFRLRKLLGRAIGAGLFXIXPAGERGNVLQGDXSWVTARGFPVTTL*NDGQ*NCNTTHYR 742 P + +LLGRAIGAGLF I PAGE+G+VLQGD +GFP + NCNTTHYR Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYR 99 Query: 741 A 739 A Sbjct: 100 A 100 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 71.7 bits (168), Expect = 1e-12 Identities = 37/73 (50%), Positives = 42/73 (57%), Gaps = 2/73 (2%) Frame = +1 Query: 715 EGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRP 894 +GG G +++LAVVLQRRDWE PG H PPFASWR EEAR DRP Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRP 109 Query: 895 SQQF--AQPEWRM 927 SQQ EWR+ Sbjct: 110 SQQLRSLNGEWRL 122 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 70.5 bits (165), Expect = 3e-12 Identities = 37/72 (51%), Positives = 41/72 (56%), Gaps = 2/72 (2%) Frame = +1 Query: 718 GGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPS 897 GG G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPS Sbjct: 44 GGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPS 102 Query: 898 QQF--AQPEWRM 927 QQ EWR+ Sbjct: 103 QQLRSLNGEWRL 114 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 70.5 bits (165), Expect = 3e-12 Identities = 38/62 (61%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +1 Query: 748 VSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEW 921 +SRIT SLAVVLQRRDWE G H PPFASWR EEAR DRPSQQ EW Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEW 146 Query: 922 RM 927 R+ Sbjct: 147 RL 148 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 1 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 59 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 60 LRSLNGEWRL 69 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 61 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 119 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 120 LRSLNGEWRL 129 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 69.7 bits (163), Expect = 6e-12 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = -1 Query: 920 HSGCANCWEGRSXRASSXXRQLAKGGMCCKAIXVG*PPGVSQSRRCKTTASEI 762 +SG NCWEGRS RASS RQLAKGG + + PG SQSRRCKTTASE+ Sbjct: 355 YSGLRNCWEGRSVRASSLLRQLAKGGCAARRLS-WVTPGFSQSRRCKTTASEL 406 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 101 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 159 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 160 LRSLNGEWRL 169 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 64 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 122 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 123 LRSLNGEWRL 132 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 29 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 87 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 88 LRSLNGEWRL 97 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 19 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 77 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 78 LRSLNGEWRL 87 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 43 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 101 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 102 LRSLNGEWRL 111 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 78 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 136 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 137 LRSLNGEWRL 146 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 724 PGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQ 903 PG +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ Sbjct: 66 PGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQ 124 Query: 904 F--AQPEWRM 927 EWR+ Sbjct: 125 LRSLNGEWRL 134 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 69.7 bits (163), Expect = 6e-12 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +2 Query: 764 FHWPSFYNVVTGKPLAVTQLXSPCSTFPLSPAGXIXKRPAPIALPNS 904 +HWPSFYNVVTGK LA+ L + PLSPAG I KRPAPIALPNS Sbjct: 61 WHWPSFYNVVTGKTLALPNLIA-LQHIPLSPAGVIAKRPAPIALPNS 106 >SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) Length = 133 Score = 69.7 bits (163), Expect = 6e-12 Identities = 35/54 (64%), Positives = 36/54 (66%) Frame = +1 Query: 766 SLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQFAQPEWRM 927 SLAVVLQRRDWE G I L PP ASWR EEAR DRPSQ+ Q EWRM Sbjct: 77 SLAVVLQRRDWENTG-VSQVIRLAVHPPVASWRNSEEARTDRPSQELLQSEWRM 129 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 69.7 bits (163), Expect = 6e-12 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRMAX 933 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 48 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 106 Query: 934 WKR 942 KR Sbjct: 107 TKR 109 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 69.7 bits (163), Expect = 6e-12 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +2 Query: 764 FHWPSFYNVVTGKPLAVTQLXSPCSTFPLSPAGXIXKRPAPIALPNS 904 +HWPSFYNVVTGK LA+ L + PLSPAG I KRPAPIALPNS Sbjct: 56 WHWPSFYNVVTGKTLALPNLIA-LQHIPLSPAGVIAKRPAPIALPNS 101 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 69.3 bits (162), Expect = 8e-12 Identities = 37/74 (50%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +1 Query: 712 LEGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDR 891 L G G +++LAVVLQRRDWE PG H PPFASWR EEAR DR Sbjct: 23 LPGDNGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDR 81 Query: 892 PSQQF--AQPEWRM 927 PSQQ EWR+ Sbjct: 82 PSQQLRSLNGEWRL 95 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 68.9 bits (161), Expect = 1e-11 Identities = 36/71 (50%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +1 Query: 721 GPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQ 900 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQ Sbjct: 1174 GKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQ 1232 Query: 901 QF--AQPEWRM 927 Q EWR+ Sbjct: 1233 QLRSLNGEWRL 1243 Score = 44.4 bits (100), Expect = 3e-04 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -1 Query: 905 NCWEGRSXRASSXXRQLAKGGMCCKAIXVG 816 NCWEGRS RASS RQLAKGG + + G Sbjct: 411 NCWEGRSVRASSLLRQLAKGGCAARRLSWG 440 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 68.9 bits (161), Expect = 1e-11 Identities = 36/71 (50%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +1 Query: 721 GPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQ 900 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQ Sbjct: 44 GEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQ 102 Query: 901 QF--AQPEWRM 927 Q EWR+ Sbjct: 103 QLRSLNGEWRL 113 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +1 Query: 844 PPFASWRYXEEARXDRPSQQ 903 PPFASWR EEAR DRPSQQ Sbjct: 19 PPFASWRNSEEARTDRPSQQ 38 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 68.9 bits (161), Expect = 1e-11 Identities = 35/63 (55%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRMAX 933 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 188 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 246 Query: 934 WKR 942 + R Sbjct: 247 YMR 249 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 68.9 bits (161), Expect = 1e-11 Identities = 36/74 (48%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +1 Query: 712 LEGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDR 891 + G G +++LAVVLQRRDWE PG H PPFASWR EEAR DR Sbjct: 75 INGEDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDR 133 Query: 892 PSQQF--AQPEWRM 927 PSQQ EWR+ Sbjct: 134 PSQQLRSLNGEWRL 147 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 68.9 bits (161), Expect = 1e-11 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = -1 Query: 917 SGCANCWEGRSXRASSXXRQLAKGGMCCKAIXVG*PPGVSQSRRCKTTASEI 762 SG NCWEGRS RASS RQLAKGG + + PG SQSRRCKTTASE+ Sbjct: 81 SGLRNCWEGRSVRASSLLRQLAKGGCAARRLS-WVTPGFSQSRRCKTTASEL 131 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 68.5 bits (160), Expect = 1e-11 Identities = 36/71 (50%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +1 Query: 721 GPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQ 900 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQ Sbjct: 68 GRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQ 126 Query: 901 QF--AQPEWRM 927 Q EWR+ Sbjct: 127 QLRSLNGEWRL 137 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 68.5 bits (160), Expect = 1e-11 Identities = 36/71 (50%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +1 Query: 721 GPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQ 900 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQ Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQ 146 Query: 901 QF--AQPEWRM 927 Q EWR+ Sbjct: 147 QLRSLNGEWRL 157 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 68.5 bits (160), Expect = 1e-11 Identities = 36/72 (50%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +1 Query: 718 GGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPS 897 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPS Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPS 96 Query: 898 QQF--AQPEWRM 927 QQ EWR+ Sbjct: 97 QQLRSLNGEWRL 108 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 68.5 bits (160), Expect = 1e-11 Identities = 36/71 (50%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +1 Query: 721 GPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQ 900 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQ Sbjct: 49 GRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQ 107 Query: 901 QF--AQPEWRM 927 Q EWR+ Sbjct: 108 QLRSLNGEWRL 118 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 68.5 bits (160), Expect = 1e-11 Identities = 36/71 (50%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +1 Query: 721 GPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQ 900 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQ Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQ 761 Query: 901 QF--AQPEWRM 927 Q EWR+ Sbjct: 762 QLRSLNGEWRL 772 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 68.5 bits (160), Expect = 1e-11 Identities = 36/73 (49%), Positives = 41/73 (56%), Gaps = 2/73 (2%) Frame = +1 Query: 715 EGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRP 894 +G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRP Sbjct: 3 KGEEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRP 61 Query: 895 SQQF--AQPEWRM 927 SQQ EWR+ Sbjct: 62 SQQLRSLNGEWRL 74 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 68.5 bits (160), Expect = 1e-11 Identities = 36/73 (49%), Positives = 41/73 (56%), Gaps = 2/73 (2%) Frame = +1 Query: 715 EGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRP 894 +G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRP Sbjct: 18 KGTKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRP 76 Query: 895 SQQF--AQPEWRM 927 SQQ EWR+ Sbjct: 77 SQQLRSLNGEWRL 89 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 68.1 bits (159), Expect = 2e-11 Identities = 36/74 (48%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +1 Query: 712 LEGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDR 891 + G G +++LAVVLQRRDWE PG H PPFASWR EEAR DR Sbjct: 15 VSGVTGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDR 73 Query: 892 PSQQF--AQPEWRM 927 PSQQ EWR+ Sbjct: 74 PSQQLRSLNGEWRL 87 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 68.1 bits (159), Expect = 2e-11 Identities = 36/72 (50%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +1 Query: 718 GGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPS 897 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPS Sbjct: 46 GRQGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPS 104 Query: 898 QQF--AQPEWRM 927 QQ EWR+ Sbjct: 105 QQLRSLNGEWRL 116 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 68.1 bits (159), Expect = 2e-11 Identities = 42/115 (36%), Positives = 54/115 (46%), Gaps = 2/115 (1%) Frame = +1 Query: 589 LPVCIQEVDGARSDFRVPRTLLVNLDTILQXXXXXXXXXXXLEGGPGTQFRPIVSRITIS 768 L IQ ++ R + RV + + +L ++ G +++ Sbjct: 48 LSASIQSINCCR-EARVSSSPVNSLRNVVAIATGIVVSRSSFGMASGDPLESTCRHASLA 106 Query: 769 LAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 68.1 bits (159), Expect = 2e-11 Identities = 35/62 (56%), Positives = 39/62 (62%) Frame = -1 Query: 905 NCWEGRSXRASSXXRQLAKGGMCCKAIXVG*PPGVSQSRRCKTTASEIVIRLTIGRNWVP 726 NCWEGRS RASS RQLAKGG + + PG SQSRRCKTTAS + L + P Sbjct: 102 NCWEGRSVRASSLLRQLAKGGCAARRLS-WVTPGFSQSRRCKTTASAKLACLQVDSRGSP 160 Query: 725 GP 720 GP Sbjct: 161 GP 162 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 68.1 bits (159), Expect = 2e-11 Identities = 36/72 (50%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +1 Query: 718 GGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPS 897 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPS Sbjct: 20 GEEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPS 78 Query: 898 QQF--AQPEWRM 927 QQ EWR+ Sbjct: 79 QQLRSLNGEWRL 90 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/72 (50%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +1 Query: 718 GGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPS 897 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPS Sbjct: 20 GDLGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPS 78 Query: 898 QQF--AQPEWRM 927 QQ EWR+ Sbjct: 79 QQLRSLNGEWRL 90 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/72 (50%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +1 Query: 718 GGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPS 897 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPS Sbjct: 40 GEGGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPS 98 Query: 898 QQF--AQPEWRM 927 QQ EWR+ Sbjct: 99 QQLRSLNGEWRL 110 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/74 (48%), Positives = 41/74 (55%), Gaps = 2/74 (2%) Frame = +1 Query: 712 LEGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDR 891 +E G +++LAVVLQRRDWE PG H PPFASWR EEAR DR Sbjct: 5 VEDKEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDR 63 Query: 892 PSQQF--AQPEWRM 927 PSQQ EWR+ Sbjct: 64 PSQQLRSLNGEWRL 77 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Frame = +1 Query: 715 EGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRP 894 E G +++LAVVLQRRDWE PG H PPFASWR EEAR DRP Sbjct: 124 EAEEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRP 182 Query: 895 SQQF--AQPEWRM 927 SQQ EWR+ Sbjct: 183 SQQLRSLNGEWRL 195 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/72 (50%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +1 Query: 718 GGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPS 897 G G +++LAVVLQRRDWE PG H PPFASWR EEAR DRPS Sbjct: 70 GQHGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPS 128 Query: 898 QQF--AQPEWRM 927 QQ EWR+ Sbjct: 129 QQLRSLNGEWRL 140 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Frame = +1 Query: 715 EGGPGTQFRPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRP 894 E G +++LAVVLQRRDWE PG H PPFASWR EEAR DRP Sbjct: 186 ENPKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRP 244 Query: 895 SQQF--AQPEWRM 927 SQQ EWR+ Sbjct: 245 SQQLRSLNGEWRL 257 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 59 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 22 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 46 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 25 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 26 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 15 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 830 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 111 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 36 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 8 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 16 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 67.3 bits (157), Expect = 3e-11 Identities = 35/63 (55%), Positives = 39/63 (61%) Frame = -1 Query: 905 NCWEGRSXRASSXXRQLAKGGMCCKAIXVG*PPGVSQSRRCKTTASEIVIRLTIGRNWVP 726 NCWEGRS RASS RQLAKGG + + PG SQSRRCKTTAS + L + P Sbjct: 26 NCWEGRSVRASSLLRQLAKGGCAARRLS-WVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 Query: 725 GPP 717 PP Sbjct: 85 FPP 87 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 85 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 129 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 19 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 150 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 54 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 18 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 57 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 210 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 30 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 45 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 37 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 72 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 19 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 97 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 70 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 25 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 143 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 56 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 85 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 97 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 29 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 122 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 74 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 28 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 33 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 93 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 58 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 37 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 81 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 81 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 18 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 62 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 21 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 105 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 40 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 64 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 88 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 38 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 1060 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 14 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 28 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 131 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 179 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 167 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 223 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 56 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 16 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 143 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 55 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 20 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 649 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 36 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 158 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 44 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 29 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 19 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 55 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 67 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 14 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 68 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 182 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 441 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 70 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 263 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 31 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 67 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 101 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 70 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 70 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 14 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 71 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 80 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 173 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 28 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 80 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 46 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 70 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 65 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 54 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 66 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 35 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 36 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRTLNGEWRL 92 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 59 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 78 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 35 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 47 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 46 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 38 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 19 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 123 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 40 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 66 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 15 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 51 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 85 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 52 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 55 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 164 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 59 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 14 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 30 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 76 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 54 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 31 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 102 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 43 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 33 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 116 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 149 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 99 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 23 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 52 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 34 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 53 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 153 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 24 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 66 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 123 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 86 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 15 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 23 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 68 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 82 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 41 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 142 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 788 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 69 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 90 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 52 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 105 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 303 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 27 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 49 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 12 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 23 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 50 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 106 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 53 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 244 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 78 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 31 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 45 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 21 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 60 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 15 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 32 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 36 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 526 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 582 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 184 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 240 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 112 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 168 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 27 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/63 (57%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +1 Query: 739 RPIVSRITISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQFAQ-- 912 RPIVSRITI +RRDWE PG H PPFASWR EEAR DRPSQQ + Sbjct: 19 RPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAH-PPFASWRSSEEARTDRPSQQLRRLN 77 Query: 913 PEW 921 EW Sbjct: 78 GEW 80 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 82 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 8 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 29 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 106 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 162 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 34 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 195 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 251 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 57 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 18 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 24 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 38 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 64 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 21 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 41 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 59 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 37 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 17 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 118 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 174 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 361 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 417 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 38 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 51 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 13 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 78 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 67.3 bits (157), Expect = 3e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +1 Query: 760 TISLAVVLQRRDWETPGGYPTXIALQHIPPFASWRYXEEARXDRPSQQF--AQPEWRM 927 +++LAVVLQRRDWE PG H PPFASWR EEAR DRPSQQ EWR+ Sbjct: 434 SLALAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEARTDRPSQQLRSLNGEWRL 490 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,564,401 Number of Sequences: 59808 Number of extensions: 739939 Number of successful extensions: 16292 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11035 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5246786319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -