SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030905E5_F05_e422_11.seq
         (1624 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8 prot...    23   4.8  

>DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8
           protein.
          Length = 496

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +3

Query: 585 LQYNVPNGKKNRGLATILAYKMVETKENMTPENIHL 692
           L Y+VP+  K      ++AY +  + E++T +N  L
Sbjct: 192 LSYHVPSLSKYLDFINVMAYDLHGSWESVTGQNAPL 227


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 300,862
Number of Sequences: 336
Number of extensions: 6537
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 49164000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -